SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|189289|estExt_Genewise1.C_sca_280290 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|189289|estExt_Genewise1.C_sca_280290
Domain Number 1 Region: 428-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-104
Family Thrombospondin C-terminal domain 0.0000000918
Further Details:      
 
Domain Number 2 Region: 305-425
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.48e-30
Family TSP type-3 repeat 0.00000903
Further Details:      
 
Domain Number 3 Region: 241-310
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000876
Family TSP type-3 repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 165-237
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000889
Family TSP type-3 repeat 0.00047
Further Details:      
 
Domain Number 5 Region: 4-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|189289|estExt_Genewise1.C_sca_280290
Domain Number - Region: 126-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-like domain of nidogen-1 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|189289|estExt_Genewise1.C_sca_280290
Sequence length 671
Sequence
MPGGFRCGACPTGYSGNGTHCEDIDECRYSRPCDALAMCENLSPGFTCTSCPPGYTSPPV
QGVGIESAKTQKQVCQDINECEDGRNGGCVPNSICINTPGSYRCGDCMEGFMGNQTIGCQ
TNGLLCPDGKTKCSEHAKCVKRRGQREYICQCKVGYAGDGKICHRDTDLDGIPDIDLGCR
GRQCRKDNCIETPNSGQEDADGDQIGDACDPDMDNDGIVNNPDNCPLVANPDQADSETAP
DKTGDACDNCPTVPNPDQTDTDSDNLGDNCDPDIDNDGILNENDSCVKVVNYDQSDVDGD
GVGDACDNCPKKQNKDQSDIDDDLIGDVCDTGNDIDRDGVQDNKDNCLTQPNADQQDTDK
DSIGDACDNDDDNDNIIDELDNCPLVKNKDQLDSDRNGVGDACENDMDGDGHPDLLDVCP
LNGEIYATDFRAYQTIVLDPEGDSQIDPNWLILNKGAEIVQTMNSDPGIAVSYNTFSGVD
FSGTFFVNTEVDDDYAGFIFSYQDSSSFYVVMWKKVTQTYWHPTPFRAVAEPGIQLKLVK
SDTGPGEVLRNSLWHTGDTSRQVKLLWKDPRNVGWKDKTAYRWELIHRPSIGLIRVLFFE
DTELVADSGNVYDTTLRGGRLGVFCFSQEMVIWSDLVYRCNEFIPRGLLSEDSESPDGEV
DYDDYYDEPLK
Download sequence
Identical sequences V4AH87
XP_009054824.1.39240 jgi|Lotgi1|189289|estExt_Genewise1.C_sca_280290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]