SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|193495|estExt_Genewise1.C_sca_530031 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|193495|estExt_Genewise1.C_sca_530031
Domain Number - Region: 63-173
Classification Level Classification E-value
Superfamily Prefoldin 0.0173
Family Prefoldin 0.014
Further Details:      
 
Domain Number - Region: 338-379
Classification Level Classification E-value
Superfamily Tropomyosin 0.0278
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|193495|estExt_Genewise1.C_sca_530031
Sequence length 422
Sequence
MATQVRPTTRFQPPDWFTNNYTISTNAERQRDASHQVRQEGRFLTNETDNQTKWDQHSNN
VRLADRVDHIRKWKEILEKTLADLDQEIADLSDSKELTEQALEAKNLPLDVAVECLTLRE
GRQGIDIVQDEAENQLHKEVEVIEGIRKNLQQRVSDSFEQICLLQEARQQIQADLQDKNI
ALGIDIDQYNLTDRSPNISYKPDSLRVPKGSTTPQQWEDFSRYNKERADAEMQASGRLRE
AIHHTLQKTDNDLEAQKIATEFALRKRIHEFERAKDELEWQKKNTEDEIAELENDIRKLA
EAIRAKTNPMKLAQTRLENRTYRPNVELCRDAPQYGLTDEVKQLEATKKALEEKLKQAQH
ALDGLEKNLHRINDDLALKNNSLMLDKRNMSVREKLNARPQTSVERNLTLTGIEREKTKV
LA
Download sequence
Identical sequences V3ZV47
XP_009060972.1.39240 jgi|Lotgi1|193495|estExt_Genewise1.C_sca_530031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]