SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|195549|estExt_Genewise1.C_sca_680048 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|195549|estExt_Genewise1.C_sca_680048
Domain Number 1 Region: 135-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000328
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 174-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000057
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 213-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 57-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000211
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 5 Region: 96-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000359
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 20-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000264
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|195549|estExt_Genewise1.C_sca_680048
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00438
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|195549|estExt_Genewise1.C_sca_680048
Sequence length 312
Sequence
MEFYCDCPDGFEGDKCETELNPCDIHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCETDPC
DSHPCHNGGTCCPTTGMEYYCDCPRGFKGKTCDIELNPCDSHPCHNGGTCCPTTGGKFTC
DCPRGFKGKTCDIVINPCDRHPCHNGGTCYPTARGRFRCDCPRGFKGKTCDIAINPCDSH
PCHNGGTCLPTTRGKFSCDCPRGFKGKTCDIAINPCDSHPCHNGGTCCPTTGGMFSCDCP
IGFKGKTCDIGYHHPYSRFRRILRSLTRRRFVRFGRRQRRFRRVITIRRIRLYGRRQRRF
RIRIRRSFIRSG
Download sequence
Identical sequences V3ZNL6
jgi|Lotgi1|195549|estExt_Genewise1.C_sca_680048 XP_009063400.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]