SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|195554|estExt_Genewise1.C_sca_680053 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|195554|estExt_Genewise1.C_sca_680053
Domain Number 1 Region: 253-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 604-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000605
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 448-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000917
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 526-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000287
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 5 Region: 202-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 721-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000044
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 7 Region: 486-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000722
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 20-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000861
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 408-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 137-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 366-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.014
Further Details:      
 
Domain Number 12 Region: 565-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000002
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 642-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000207
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 98-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000221
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 678-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000496
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 59-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000712
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 760-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000771
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 327-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 177-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|195554|estExt_Genewise1.C_sca_680053
Domain Number - Region: 2-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0191
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|195554|estExt_Genewise1.C_sca_680053
Sequence length 797
Sequence
MEYYCDCPKGFEGDKCQTELNPCDSHPCHNGGTCCPTSGMEYYCDCPKGFEGDKCQTELN
PCDSHPCHNGGTCCPTSGMEYYCDCPKGFEGDKCQTELNPCDSHPCHNGGTCCPTSGTEY
YCDCPRGFEGDKCETEVNPCDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIELNPCD
SHPCYNGGTCCPTSGTEYYCDCPKGFEGDKCQTELNPCDSHPCHNGGTCCPTSGMEYYCD
CPRGFEGDKCQTELNPCDSHPCHNGGTCPTSGTEYYCDCPRGFEGDKCETEINPCDSNPC
HNGGTCCPTTGGKFSCDCPKGFKGKTCDIEINPCDSHLCHNGGTCCPTTGGKFSCDCPKG
FKGKTCDIEINPCDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIEINPCDSNPCHNG
GTCCPTTGGKFSCDCPKGFKGKTCDIAINPCDSHPCHNGGTCLPTTRGRFRCDCPRGFKG
KTCDKEINPCDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIVINPCDSNPCHNGGTC
YPTTGGKFRCDCPRGFKGKTCDIEINPCDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTC
DIAINPCDSHPCHNGGTCLPTTRGRFRCDCPRGFKGKTCDKEINPCDSHPCHNGGTCCPT
TGGKFSCDCPRGFKGKTCDIEINPCDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIE
INPCDSNPCHNGGTCCPTTGGKFSCDCPKGFKGKTCDIEINPCDSHPCHNGGTCCPTTGG
KFSCDCPRGFKGKTCDI
Download sequence
Identical sequences V3ZTP1
jgi|Lotgi1|195554|estExt_Genewise1.C_sca_680053 XP_009063403.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]