SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|198809|estExt_Genewise1.C_sca_1080007 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|198809|estExt_Genewise1.C_sca_1080007
Domain Number 1 Region: 658-915
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-57
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 2 Region: 354-610
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-57
Family YWTD domain 0.000000918
Further Details:      
 
Domain Number 3 Region: 1270-1527
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-54
Family YWTD domain 0.00000119
Further Details:      
 
Domain Number 4 Region: 965-1216
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-52
Family YWTD domain 0.00000484
Further Details:      
 
Domain Number 5 Region: 67-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1225-1268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000439
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 7 Region: 152-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 8 Region: 192-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 9 Region: 231-267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 302-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000051
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 28-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 272-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000804
Family EGF-type module 0.023
Further Details:      
 
Domain Number 13 Region: 111-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 14 Region: 614-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 921-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000054
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 1527-1566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|198809|estExt_Genewise1.C_sca_1080007
Sequence length 1750
Sequence
MCNNNRCIKNDWLCDSDNDCGDDSDEFGCPPRKCTPDELKCNNNKCVAKEWQCDGDDDCG
DGTDEICPHRPCDKNEFECDNGLCIMSEWVCDKDPDCGDFSDEKNCDKNRMACRKNEFRC
SKNGLCLKNRYKCDSVNDCGDWEDEIDCGSNLCHDGEFNCTSGVCINKKWRCDGDFDCED
GSDEEGCDVKKGCKKGEFECSTGVCIPDTWRCDGTDDCTDNTDEVDCKKKECPKGQFLCD
DGKCIGRQKVCNGKPECLDGSDEKLCNLPASCDKVNGGCQHHCTESPIGAICTCQLGYQL
QDDGRSCKDVDECEFDSSCSQKCYNTIGTFKCECVKGYVLKQDGRSCKALGGEAYLIFAN
RVDIRRVTTDQSEYTSILKGLRDAIALDFHHEKGLVFWSDVTLDTIKRAYLNGSEVIEII
HGGLDNPGGLAVDWIHDKLFWTDAGTSRIEVANLDGGYRKVLYWTDLEKPRAIAAYPHKG
WIFWTDWGTVPKIERGSMDGSRRLAIANTSLFWPNGLTMDYAAERIYWADAKHHVIECAD
LDGSHRRTVINQGLPHPFALTLFEDELYWTDWHTKSINKANKFNGNNIETVRNRLHFPMD
IHTFHPQRQPPADNHCGLDNGGCSHLCLPNERHYSCACPTGLHLTDNDKICTSKINTFLL
FSTQTDIRRVTLETPDLTDVVIPLSDVARSIGVEWDSESDHIYWTDVITDVIGRAKWDGS
EQEIVIGSSLETPAGLALDWANHKLYWTDAENDRIEVANLDGKMRTVLLWKDFDQPRDIV
VDPMTGYMFWTDWGKMPKIERAGMDGSERMILFHENITWPNGLAIDFDEERLYWTDAHMK
TIESSTLEGKDRRYVIELGLDHPFGLALYGELMYWTDWTTESIHYANKKTGRNRGVLLSD
LGNLMDIHVYHQGRQEVATTCSNKNGGCSDVCLVAPLPTSHTCTCPTGILLKSDNKTCET
EMKHFLLFTRRTDIRKISLDVPYYADTVVPVGELMNTIAIDVDKAEGKMYWTDTVADTIC
RSNLDGSQREIVIEKGLRTADGLAVDSVGRKVYWTDAGHKTIEVATLEGKMRKVLIWKGI
QKPRAIALHYEKGYLFWTDWGDKPSIWRADMDGENSKTLIKDQLVWPNGLAVDYTTDKII
WCDAKTEVVECSDFSGHYRRVLVAKVAHPYGLAVSGNWIYWTDWRATSINRANKHTGKNI
TVIRGNLHGVMDVHAVDMELIETFVNKCGRNNGGCSHLCLPKPNGYSCACPSGVILLPDK
KTCQNMPTKYLLFASRSNIHYISLDTDDRSDVYLPITDLHNVVALDYDYTNKKIYYTDVF
LDVIRRCDLNGSNVETVIENKLSTTDGLAVDWISQNLYWTDTGRDVIDVSRTDGTSRKTL
ISTGLDEPRAIALFPKKGLMFWTDWGVNAKIEKAYLDGSSRRTIIDENLGFPNGLSIDYE
DKRLYWVDAKLDKIETSDLNGRNRVTLLHNIPHPFGLTVFGDYIYWTDWVTESIDRANKR
TGLNRKIVKEKLEGPMDLHFVSPDRQIGTNPCSEKNGGCTHLCLALPNTYVCECPNQPDH
RACLKIPLKDGLPDDISNIDGQYNICNEENRKNGKCTEPNQSRDKSKVHGAYIALMVITI
LVLIGFLIFFIIWKRQRRRRYNMDDFTSYANPTYQKTSTETINSDTRSVRGWSLFHYRKN
EERIRMMPPNNSSTNHPETTALVHQMEFHSPSPSPQINHHHHRDVTKNIYKNNPPYTDML
PNISYHPVDT
Download sequence
Identical sequences V4BEE3
jgi|Lotgi1|198809|estExt_Genewise1.C_sca_1080007 XP_009045108.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]