SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|200309|estExt_Genewise1.C_sca_1390017 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|200309|estExt_Genewise1.C_sca_1390017
Domain Number 1 Region: 17-72
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000837
Family Tachycitin 0.011
Further Details:      
 
Domain Number 2 Region: 586-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 242-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000304
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 4 Region: 267-401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000832
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 510-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 664-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000059
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 626-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.022
Further Details:      
 
Domain Number 8 Region: 122-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 548-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000514
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 360-476
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000832
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 472-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000177
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 78-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000322
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 703-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000005
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 206-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 164-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000164
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|200309|estExt_Genewise1.C_sca_1390017
Sequence length 739
Sequence
MRVLIAAIAICLVQYVSAACELGSYASHDTDCSKFKQCNHGSWVIKDCPPPLQWDQSLMT
CNWPNAVNCDSNDGPLSDACSTSPCVNGLCFLSSTSASGYSCICNAGFNGDRCENSVVNN
ICQQSNPCLNNGACTATNTGYICSCPTSYTGINCETYQPTSVNCASGISGTECQNGGVCV
WDGNFRCSCLTPYTGARCEKNGITGDACSVNPCNNGVCRISSTSRGYTCDCSVPYIGDNC
ENYNFCAVEPCLNGGQCYNEPNNYLCTCTGGYTGNNCQFGNSCASNPCGSRGLCSESGSS
YYCACDIGYYGTNCENSVPTDSCASNPCGSRGTCSVAGSSYSCTCFNGYYGTNCENSVPT
NPCLSDPCKNGGGCQVQGSTYTCSCPAGYIGTNCEFRNSACDNSPCGIGGQCSTIGSSYQ
CKCYTGYTGTNCEVRFDACSLNPCVNGACQVSGNSYVCNCNTGYTGTNCDSTDNCNPNPC
GLHGSCTNTGPSFFCNCDDGYLGYRCDFRDFCASGPCLKGGQCTNTNNGYRCDCPDGTIG
ENCEFSLTDRCFSSPCQNGGVCTNDIFSGYVCSCPTGTSGNNCQNKVDFCRGQPCENGGI
CENGVDTFICRCRPGFFGIFCEFEGTIDYCLNHQCQNNALCVSEELGYACVCQFGFSGDL
CENGITSCENNACLNGATCISDGDRQYSCNCPLGFTGEFCESSTDPCNNNNCQNGGICNA
NPFGGYDCQCPRGYTGTYC
Download sequence
Identical sequences V4CH98
XP_009047804.1.39240 jgi|Lotgi1|200309|estExt_Genewise1.C_sca_1390017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]