SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|202917|estExt_Genewise1.C_sca_56480002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|202917|estExt_Genewise1.C_sca_56480002
Domain Number 1 Region: 63-188
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 2 Region: 40-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000621
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 2-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|202917|estExt_Genewise1.C_sca_56480002
Sequence length 191
Sequence
VDLCSPNPCQNNGFCQPSGTSFSCTCQGGYTGSTCQTIANPCLPNPCKNNGFCQPSGTSF
LCTCQDGYAGTTCQTIANPCLPNPCKNNGFCQPSGTSFLCTCQAGYAGTTCQTIANPCLP
NPCQNNGFCQPSGTSFLCTCQAGYTGTTCQTIANPCLPNPCQNNGFCQPSGTSFLCTCQA
GYTGTTCQTIG
Download sequence
Identical sequences V3ZTS2
jgi|Lotgi1|202917|estExt_Genewise1.C_sca_56480002 XP_009061525.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]