SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|202995|estExt_fgenesh2_kg.C_sca_10047 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|202995|estExt_fgenesh2_kg.C_sca_10047
Domain Number 1 Region: 41-170
Classification Level Classification E-value
Superfamily Prefoldin 9.55e-26
Family Prefoldin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|202995|estExt_fgenesh2_kg.C_sca_10047
Sequence length 185
Sequence
MATESQGEDMNNHSGIPESDFVDNVDEFMQKQENENAESVLRKLDERHNKYKFMEYNLNT
KKSRLKTQIPDIKTSLDIVKHLLERKTNADPLETRFLLSDQVYAKAKIPPTDKVCLWLGA
NVMLEYNLDDAQKLLEKNLGTAKKTLGQVDDDLSFLRDQTTTLEVNMARVYNWDVKRRQK
APVKS
Download sequence
Identical sequences V4B4G6
XP_009043903.1.39240 jgi|Lotgi1|202995|estExt_fgenesh2_kg.C_sca_10047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]