SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|205198|estExt_fgenesh2_kg.C_sca_1480006 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|205198|estExt_fgenesh2_kg.C_sca_1480006
Domain Number - Region: 323-414
Classification Level Classification E-value
Superfamily Prefoldin 0.0141
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|205198|estExt_fgenesh2_kg.C_sca_1480006
Sequence length 459
Sequence
MAFSDIARTPRTPMSPMMSKVLPYVSDKTSSRHLGRSLDMGHAKAYYNPANKSVYNRYSV
GDWGQSNNSHFNLSSKERSYGERLRADAWRAIQETDSRTRNRQNEVTKRLGERVTDIAFW
KSELNTEINQMATEIENLKEYRRVLEKALGDTANPLHVAEECLMHREKRRGIDLVNDDVE
KSLIKEVQLIKHCQGKMKRVLDKAMAQLKVNRAAQHALEVDCKDKHHAQHLDDRMQQLRN
SSAGIGYFPSIENVDNTITIPESWARYTHENVIRSQKERAASEKLRGEIDSCMRSCANEM
WSIFNAVNNNFNMRIHDTSDARNKLQAHLQRTMQEIFDMERNIHLLRKAIQDKENPMKVA
QTRLDERTRRIHVEVCHDPVMKTLKHEVNDIRESIAILKKSLRESELSLARLMKTKAVLE
NDIGVKENSLKLDSQLCMGMRKGFPMDPKVGPIFQMPTC
Download sequence
Identical sequences V4CFK8
jgi|Lotgi1|205198|estExt_fgenesh2_kg.C_sca_1480006 XP_009048516.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]