SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|208735|estExt_Genewise1Plus.C_sca_20112 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|208735|estExt_Genewise1Plus.C_sca_20112
Domain Number 1 Region: 309-527
Classification Level Classification E-value
Superfamily GFP-like 1.78e-59
Family Domain G2 of nidogen-1 0.0000079
Further Details:      
 
Domain Number 2 Region: 951-1185
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-42
Family YWTD domain 0.000003
Further Details:      
 
Domain Number 3 Region: 267-306,533-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000107
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 906-944,990-1003,1204-1249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000314
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 763-900
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000051
Family Growth factor receptor domain 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|208735|estExt_Genewise1Plus.C_sca_20112
Domain Number - Region: 619-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 658-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0296
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|208735|estExt_Genewise1Plus.C_sca_20112
Sequence length 1257
Sequence
MAPLYLALCMISLVHGVPLRLFYSYGENARNNVTLNVGDDVSSDEVTLNTPIAFYENYYR
NVYINVNGHLSFETELPDYRATLVLPIGFKIIAVYLSDVDTRGTGKVYYRETQDKSSLQR
AALDIQTHFTGQESFEPTSLFIVTWDKVGYYKQGTDKTNTFQLVIASDGRDSFAIFNYLD
NGMGWVTGDGKTTPSLPDVPAQAGFDSGERQRFVKLPNSGTTTSYVNDTNVNVPGSWMFH
IGNTGGSNIASADLNTGEVVIFEVDQEQSCLEGARQCHINAKCVDFDSGFCCECQKPYYG
NGRQCLEPGVPQRLNGKVFGTVNGYRLQDLDQHTYVVTSDGRAYTAISRVPPELGVGLQT
LNTLGGVIGWMFATQIHPSAKNGYAFTGGEFNRTVTVTFFDQNNEKKLRIYQYFFGHDAL
NNMRMESRLDGVIPQIPIDAKVSVDDYKENYKKVAPGVIKSFSTRTYRINEVAYRYTWDQ
TIYFKECMNDPMKDEGEITQLSITRSFVVYNEQDQVVRYAGSNKVGVYAGQDPCSNAAQN
CDSNADCIPVGESYRCACRVGYGGDGVTCQDVDECSFELNTCDENARCFNVPGSFQCQCE
NGYLGDGIICRPDLEECGGRYCDVNAICSDRRGRPMCECKSGFAGNGIECYPVEFGCNEA
DICGENAECIFDNDDGKYRCECMDDFSGDGIVCEPTRGRIDCEKCDSNAQCNYDVERFVF
RCQCNAGFTGNGYSCSPLDDCSLCDPNADCLFDRTENKNRCYCRRGFYGDGNRCQRYDCQ
RQQVCDPNADCVKDGEFNICECKSGFRGDGRRCVVAECNIVNNCDVNAQCIPDQRDTRRY
LCQCNPGYEGDGRVCIQRVVPCNQVNNCSPYAECLYNPDNLSYRCRCGSGYQGDGYQCRR
RTDLVDCNKNSSLCDSNASCLFLVDQYACVCNDKYRGNGARCVPIVGKGNYLIYAQGYKL
MKTPHDSSEFTYGEQIVSDPEQLAIAVETDCKTGYLYWTDVYGGQIKRSNLDGSNSQVIL
DGLSSPEGLAVDYVSGNIYYTDSGLDVIGVSKLDGSAKSTLFKQNLENPRSIVIDVSRSV
IYWTDWNRNGPKIERGSMDGSERKTIVETDLGLPNGLAIDVTTQQLCWADAGARKIECAR
SDGVGRRIIYDQAQYPFGLTFVDNVLYWTDWEKKQIISFNRDTGASGNLNLAPGGNGKLY
GITAVRNTCPQITNACSFNNGGCRFLCLPTPRGGRKCMCADNVDPRRCNEIFNTSKK
Download sequence
Identical sequences V4ART3
jgi|Lotgi1|208735|estExt_Genewise1Plus.C_sca_20112 XP_009051417.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]