SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|210667|estExt_Genewise1Plus.C_sca_60437 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|210667|estExt_Genewise1Plus.C_sca_60437
Domain Number 1 Region: 8-112
Classification Level Classification E-value
Superfamily Prefoldin 9.55e-28
Family Prefoldin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|210667|estExt_Genewise1Plus.C_sca_60437
Sequence length 126
Sequence
MSEGLQKRLETEIEKFQSCQKDLQKYITSRQKLEAQLSENTLVKTELDLIKDDGTVFKMI
GPVLVKQELEEAKQNVQKRIDYINGEIKRHEGLIKDVEKKQEAHKESLSKLQHQYQQAQV
KAATKA
Download sequence
Identical sequences V3ZSB5
XP_009062208.1.39240 jgi|Lotgi1|210667|estExt_Genewise1Plus.C_sca_60437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]