SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|211656|estExt_Genewise1Plus.C_sca_100189 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|211656|estExt_Genewise1Plus.C_sca_100189
Domain Number 1 Region: 153-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000809
Family Laminin-type module 0.06
Further Details:      
 
Domain Number 2 Region: 599-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 3 Region: 807-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 702-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.00061
Further Details:      
 
Domain Number 5 Region: 315-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 6 Region: 757-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000809
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 268-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 212-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family Laminin-type module 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|211656|estExt_Genewise1Plus.C_sca_100189
Domain Number - Region: 655-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family Laminin-type module 0.0053
Further Details:      
 
Domain Number - Region: 855-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 562-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000248
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 1170-1409
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000314
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|211656|estExt_Genewise1Plus.C_sca_100189
Sequence length 1493
Sequence
MLPSFLLSEKAFSITYVRIRFHSPRPESFAIYKRNGNNPWIPYQFYSGSCEKTYGLARRG
VILRDNEAVAICTDEFSDISPLTGGSVAFSTLEGRPSAFQFEDSPILQDWVTATDIKIVL
TRMNTFGDEVFGDPQVLRSYFYAISDLSVGARCQCNGHANECYTYSQGIEDQQICKCEHN
TTGSNCQECLPFFNDRPWSRAYETEANECRPCNCNGLSNQCYFDAELYRRTGHGGHCEDC
RDNTDGVNCERCLVNHYRRQPENRCRDCQCNEIGSESMQCDGTGQCRCKPGVAGSKCDRC
ETNYYDFGALGCRQCSCSAAGSLDGESRCDPRTGSCSCKVNVEGQNCDTCKPGFFGLSEN
NPAGCLPCFCYGHASVCDVSPSFFARTISTDFETGKQRWNAVDRRNTEVAIQYNGILQNV
GVSAPGADAVYFNAPARYLGNQRFSYNQHLMFKLKIGEETARASVIDIIIEGSGQQISIP
IFAQGNPVPTIINQDYKFRLKDGKQYQWVPTLKPQDFITILANITGIKIRATYNAEGVGF
IDDIKLETARRGFEGGVEASWVERCTCPLGYVGQFCESCAPGYKRDPANGGPFSKCVPCQ
CNNHSDICDVNTGKCICQHNTMGANCERCNNGFYGDARGGSSDDCQACPCPGGGACIQAA
NKEVVCTDCQDGYGGNRCEYCTDGYFGDPEGRYGDRRQCQTCFCNENIDPNAVGNCNSTT
GECRKCIYNTAGFYCEKCLIGYYGEALKLPKGDCESCNCFQNGTRKDIGCDQTTGQCACL
PHVIGPRCDSLEIGFWNINSGNGGEPCDCDRIGSTNITCNPYTGQCECKVGVSGRRCDTC
QRYHYGFSMEGCTACDCAAEGSLDYQCDEYGNCPCRTNVDGRRCDRCAENKFNISAGCID
CPPCYDLVQERVNIHRGKLRDLSNLINNIEANPGLFNDTEFINHLKTVNKSVNVLLNDAR
GASTGDGTIGKQLQDLRKALNDVLDKCAKISNSINVATDVSSQSFTDIKQAEEAIDRAET
ALRAAEDYIDSEGKIALERALEALDKFGKQSQQMTQIAQRATKESTRQMEDAERIELMAK
EAQNTSREALRLAQEAFSQPDKTSREIQLLNQDHDNADRLYSQTEVIAERTQILAKEAHD
DAISLYSEAQRQVPKVDVDQLINDVDQIKEEAGKIKSEAERLLEQNEQLLKDVAEKQGSA
ETKLDDGVRLQQRADELLAEVDAARATARNAVDLGEKTLKEANETLATLKGFDELVQESK
GKANDALTKIPDIERTIKEAEDTTKEAQNALSGAELDAQEAYRLAQEAQSTAEDASEEAS
RIRNESNQTKDKAIGLKEEADDLADDVSNADARLKDLETQADEDSSLSKEALENANTAKL
TAEEASDKVAKALQTVENIIRILGSLDSANPGELDQLEQDLNNIEKDLNDTNIEQEFTQL
NAANEQIKRSARKYSEDYSQLEKDVNNIEDIKNSLPDQCFKSIEIESPAAGGR
Download sequence
Identical sequences V4BBD0
jgi|Lotgi1|211656|estExt_Genewise1Plus.C_sca_100189 XP_009044345.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]