SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|212293|estExt_Genewise1Plus.C_sca_120041 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|212293|estExt_Genewise1Plus.C_sca_120041
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily Prefoldin 0.0126
Family Prefoldin 0.028
Further Details:      
 
Domain Number - Region: 14-165
Classification Level Classification E-value
Superfamily t-snare proteins 0.051
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|212293|estExt_Genewise1Plus.C_sca_120041
Sequence length 220
Sequence
MNRLFGRGKPKEPPPNLNDCISNIDSRGESIDKKVARLDAELKKYKDQMKKMREGPAKNT
VKQKAMRVLKQKKMYESQRDQLSNQSFNLEQQNFAISSLKDTKTTVDAMKVGVKDFKKAY
KHVNIDQIENMQDELEDLMEMADEVQDVMGRSYGMPEVDDDELEAELDALGDEIGFDEDT
TYLDDAVAAPSAPVGDPGDSMRGDVPVDEFGLPQIPQSAK
Download sequence
Identical sequences V4AYQ5
jgi|Lotgi1|212293|estExt_Genewise1Plus.C_sca_120041 XP_009046243.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]