SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|217219|estExt_Genewise1Plus.C_sca_370290 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|217219|estExt_Genewise1Plus.C_sca_370290
Domain Number 1 Region: 16-141
Classification Level Classification E-value
Superfamily Prefoldin 4.45e-25
Family Prefoldin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|217219|estExt_Genewise1Plus.C_sca_370290
Sequence length 158
Sequence
MAAKSPQQIDISQLPIQQLNQLAQQVEQELEFFQTSLTQLKIAQGKFVESQECMNKVTKE
NVDKEILVPLTSSMYVPGQLSNADNVLIEIGTGYYIEMSVDKGKDYFKRKVEYISKQMEK
IQPILQEKYKAKQAIVEILQLKVQAQIAAQGQSPPAKA
Download sequence
Identical sequences V4A5T3
jgi|Lotgi1|217219|estExt_Genewise1Plus.C_sca_370290 XP_009057377.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]