SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|218536|estExt_Genewise1Plus.C_sca_470114 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|218536|estExt_Genewise1Plus.C_sca_470114
Domain Number 1 Region: 278-403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 404-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000235
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 169-291
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000659
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 73-199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000675
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 659-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|218536|estExt_Genewise1Plus.C_sca_470114
Domain Number - Region: 523-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00018
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 594-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 626-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0034
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 697-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0104
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 558-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0181
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|218536|estExt_Genewise1Plus.C_sca_470114
Sequence length 788
Sequence
MRLKIILGIYIICATGSCYSEKITDNNVPAVDTKDYDYGEEEQGQESFKVPMVFWPEDNP
NVNTIEDNRIIEDNDINNISQCPDNNPCEHYCSYYYQQKPLCWCYPGYKIKTDNISCEDR
NECEEGLCLNDGICTNTLGSFVCNCKPGFYLDPSGRCVDIPDCLDEHICGDEAARCEEVP
GSYKCICNPGFKYRDGVCQDLNECSVVNCEEKKVCVNTRGSYKCQCAPGYKDVYGTCQDI
NECRMGGKACPDEMLCKNTDGSYICTCPLGFRKHANQCTDIDECAENIHTCHHYAYCGNV
PGSFFCQCGKGFSGDGRNCFDVNECERNNGECSHICINYPGHYRCLCEQGFRLENDGITC
TDIDECEKNNGNCHQLCENTEGSFTCSCRDGYTLHIDGKTCVDINECLIDNGGCSQICTN
TNGSFICSCPSHQVLDDQSQCRPIMSCADKNGGCGQKCQDLSDGSMLCSCIDGFYLHDDY
KQCIDIDECKVMNGGCEQQCINTPGSFQCSCYSGYKLLIHRDNVHKCEAICEPKCMNNGK
CISPNQCLCPVGYPGPRCTARCNPPCAHGGACHRHNQCICSPGWTGHGCITAVCSPGCQN
GGKCIAPNQCQCKTGYSGSKCQTPICIPSCKNGGLCRQPNVCSCQQGFSGVRCTQSAPTC
SPKCQNNGRCIGINRCRCPRGFSGSRCQNAFRRGPSCRPVCKNGGKCLRGNQCECLEGTS
GFRCQTSNCRIVTYKESIKRGIRIPVRESFTVKCGRFGWKQCTAYRMVQKHVFKTTYKVA
YRRKCPLN
Download sequence
Identical sequences V3ZZ95
jgi|Lotgi1|218536|estExt_Genewise1Plus.C_sca_470114 XP_009059539.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]