SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|219009|estExt_Genewise1Plus.C_sca_500165 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|219009|estExt_Genewise1Plus.C_sca_500165
Domain Number 1 Region: 314-511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.16e-37
Family Laminin G-like module 0.00048
Further Details:      
 
Domain Number 2 Region: 576-751
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-36
Family Laminin G-like module 0.00028
Further Details:      
 
Domain Number 3 Region: 56-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.12e-34
Family Laminin G-like module 0.00095
Further Details:      
 
Domain Number 4 Region: 3-76
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-18
Family I set domains 0.0094
Further Details:      
 
Domain Number 5 Region: 514-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000461
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 6 Region: 254-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|219009|estExt_Genewise1Plus.C_sca_500165
Sequence length 775
Sequence
MKTAPLGSSTTLSCETRGYPQPVVTWSKQNGDLPSEHRIIDSNLEIERVREEDSGTYYCN
AANRYGSVRFPIRLVVGALVPYFAQNPNSYISYAPLQSAYLDFDVVLSFRPEATDGMLLY
NGQQANENGDFMCFGLNSAYPEFRFDVGAGPAIIRGQEPLEMNKWHTVQLKRHQKNGTLI
VNDQPAYSSIAPGQFQGLSLSDNMYLGGVPNYQAIAPSAGYSSGFVGAVSQVQLQGLPLN
LGGDAIEIYGIESYNVCQDRPCLNRGSCIPENNQFGYRCVCARGYAGFRCEVAGESCYVG
ACGATGRCVDLSTGGFQCVCPMGQTGLGCRQAVTIIDPAFNKTSFISYPTIKKGLLQMNA
KIMFKANSLDDGIILYNAQQQDGRGDFVAILIKDGHIEYKYDTGSGIAKLRSRRPVQLGE
WTSVVAEREGRDGTLMVNNEEPVNVTSAGKTIGLNLKRPLYLGGVDPQDSISSSVGTLSG
FVGCIAELKINNEVIDLIKDAIESSAVRDCGDRSLCDRKPCLNNGICYDRGTSDYTCQCP
PQFTGTNCQTEINICITSQPCRNNGICRVTVSGFKCDCPLGYMGLNCESGNYHKLFVGDG
YIELSKSLLPHRIRQAGENISFTITTVESEGLMFWQGQDAGSTLRGADYLAISLSDGYIQ
YKYELGSGAGIIMSTIPVNDGYPHKIHVSRLGRTGNLTVDNEQPITGSAPGRLQVLNVQG
NVYIGGVPKITEMTDGDYKSNYNGCISDINILKKGPLNIGKDNEVLGGYNVRPCN
Download sequence
Identical sequences V4A6I5
jgi|Lotgi1|219009|estExt_Genewise1Plus.C_sca_500165 XP_009060528.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]