SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|219822|estExt_Genewise1Plus.C_sca_570001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|219822|estExt_Genewise1Plus.C_sca_570001
Domain Number 1 Region: 18-120
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000068
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|219822|estExt_Genewise1Plus.C_sca_570001
Sequence length 132
Sequence
MTTVKETESDAQVTFEDQQKINKFARHNARLQDIKDELAEKRKEVQNLEDAADELLMVDD
SDFVPYQIGEVFVSSSVTDATSLLERGKERALDEIKELEERGGSHKQILSDLKVQLYAKF
GNNINLEAEDDS
Download sequence
Identical sequences V4A2W5
jgi|Lotgi1|219822|estExt_Genewise1Plus.C_sca_570001 XP_009061545.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]