SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|221093|estExt_Genewise1Plus.C_sca_680073 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|221093|estExt_Genewise1Plus.C_sca_680073
Domain Number 1 Region: 141-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000152
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 106-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000224
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 340-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000492
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 184-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 301-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000059
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 418-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000059
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 28-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 496-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000152
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 219-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000192
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 535-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000258
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 11 Region: 258-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 67-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000384
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 453-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000487
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 378-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000444
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|221093|estExt_Genewise1Plus.C_sca_680073
Sequence length 574
Sequence
MWAIYIVLICLPFGVLGESIPEDEPCDPDPCDSHPCHNGGTCCPTTGMEYYCDCPRGFKG
KTCDIELNPCDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIVINPCDRHPCHNGGIC
YPTTRGRFRCDCPRGFKGKTCDKEINPCDSHPCHNGGTCLPTTRGRFSCDCPRGFKGKTC
DIELNPCDSHPCHNGGTCCPTSGTEYYCDCPRGFEGDKCETEVNPCDSHPCHNGGTCCPT
TGGKFSCDCPRGFKGKTCDIEINPCDSNPCHNGGTCCPTTGGKFSCDCPKGFKGKTCDIE
INPCDSHPCHNGGTCCPTTGGKFSCDCPKGFKGKTCDIAINPCDSHPCHNGGTCLPTTRG
RFRCDCPRGFKGKTCDKEINPCDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIEINP
CDSHPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIAINPCDSHPCHNGGTCCPTTGGKFS
CDCPIGFKGKTCDIELNPCDSHPCYNGGTCCPTSGMEYYCDCPKGYEGDKCQTELNPCDS
HPCYNGGTCCPTSGMEYYCDCPKGYEGDKCQTGL
Download sequence
Identical sequences V3ZY60
XP_009063404.1.39240 jgi|Lotgi1|221093|estExt_Genewise1Plus.C_sca_680073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]