SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|224870|estExt_Genewise1Plus.C_sca_1270022 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|224870|estExt_Genewise1Plus.C_sca_1270022
Domain Number 1 Region: 398-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000107
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 518-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 363-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000032
Family EGF-type module 0.024
Further Details:      
 
Domain Number 4 Region: 475-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.063
Further Details:      
 
Domain Number 5 Region: 288-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000048
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 324-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000643
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 7 Region: 438-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000508
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|224870|estExt_Genewise1Plus.C_sca_1270022
Sequence length 598
Sequence
MSEVYLWICVLFVYAGEVSNSGVFEVKIRSLFNKHGRTVSGRCCAGPEVDDACTATCRTF
FTLCLLHYQKPVPVYPACTFGETKTQIVGANNIGIGIGAEPAFSVAIPFSFSWPGNFAFI
LDAWHDQHRNKSTSDTRHIILRASRAKRLKPSPLWVEDERLTRTSRLEFSYRVTCDENYH
GLGCDKWCKERDDQFGHYRCTQGGVKVCSQGWQGELCDKVQCPKSCLKSNGFCDKPLNCI
CQSGWRGRDCQECVTDVKCLRGYCKTAWQCICNDGWSGSYCNIYNDYCESYSPCFNGAEC
VPDDTKNYTCNCRAGFMGDNCEKEYCYTGFCLNDGLCEEVGTKRVCRCTKGYSGERCQNV
NPTCGEMACKNNGTCMRLKKKWACSCLPGYHGHFCEIEKNECASNPCKNGGSCRDRVNGY
HCVCADGFAGINCDLIFDPCLGIQCFNGGKCHKRGFFNAGCACLANYTGYRCETPRNPCY
GVHCQNGGQCVVGKAKKVSCSCTDNWTGKLCQFEKEKKNICASHPCPEGSVCKSYTDNYI
CICSKELKGDNCDQTKLSSDDPDSKVIHNNSKNSAVILFHNSFLFFIILLAIKMAIVS
Download sequence
Identical sequences V4AXT1
XP_009046936.1.39240 jgi|Lotgi1|224870|estExt_Genewise1Plus.C_sca_1270022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]