SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|225988|estExt_Genewise1Plus.C_sca_1560073 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|225988|estExt_Genewise1Plus.C_sca_1560073
Domain Number 1 Region: 242-311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.01e-18
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 184-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.34e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 65-132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 122-194
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000328
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 5 Region: 422-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000131
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 6 Region: 302-364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000612
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 7 Region: 471-545
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000675
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 361-423
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000059
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|225988|estExt_Genewise1Plus.C_sca_1560073
Sequence length 563
Sequence
MAITYDLYSDSIISVCNEQCTRRENVGKRRCSKRCITNQDCVSAKKKCLCDGVCGLSCIN
PNAGCDLLPPISYGRVDIIPPNMIGGRARYSCYPGFHLVGRSERTCQPDGKWDGAPPSCE
KVVCGRPPEVEHASHDAPDQLQFQSGTHLTYTCVFGYYREGAPRAVCTGEGQWVGPKMTC
KARNCGAPGEINNGWRDPGYKFTFPSRVTYHCDEGFELLGRAYRECQSNGEWSGILPTCE
PIQCQELGPPLHGTMIGSGRTYGSIIKFVCNDGYKVVGSDERRCQAGGMWSGQEARCEEI
DCGIPGPVYNGYIDGHRTSVGAIFFYRCYARTTYDGTSFFAQCLENGQWSQPPPRCLGQC
AVPAILNGSVVNGREGVWVDHGTAINYTCKEGLQLNDTSINTCNNGTWRFIPRCLPAPCK
SPPPLIENGHRVFFTMNHGDRARYFCMEGYRLYQSNKYLTCNFGAWEGVRPYCEENFCPN
PGTLTNGQIYKKGHVGKFRFKEYIVTIKHGDRLEYECHRNFKLQGPKGAACVNGKWSPQQ
KPKCVPARHPILPKLWRPMEELS
Download sequence
Identical sequences V4A8G6
XP_009049073.1.39240 jgi|Lotgi1|225988|estExt_Genewise1Plus.C_sca_1560073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]