SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|226808|estExt_Genewise1Plus.C_sca_2050014 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|226808|estExt_Genewise1Plus.C_sca_2050014
Domain Number 1 Region: 415-521
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000000144
Family Mannose 6-phosphate receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|226808|estExt_Genewise1Plus.C_sca_2050014
Domain Number - Region: 219-280
Classification Level Classification E-value
Superfamily EF-hand 0.000104
Family Polcalcin 0.064
Further Details:      
 
Domain Number - Region: 42-73
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000157
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 76-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00072
Family LDL receptor-like module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|226808|estExt_Genewise1Plus.C_sca_2050014
Sequence length 538
Sequence
MTEKAIILALCLLYYFVPDAHCGIDRPRGVPASKASYYKPGETFKCITDGKTIPFEYIND
DYCDCDDGSDEPGTSACPMMMFYCENKGHKPEYILSSRYNDGICDCCDGSDEFGGEKIQC
QNFCEEIGRKDREDRERLILLQTEGFKVKLSYIQLGQSLQQEKKARLTEIASEKDTYEKL
KTDLEAKKNEAEAPEKEAKEKHEKAWEEEKEKKKAVKERETALMAFDEIDANDDQHVEIH
EMLLHPEFDIDSDGTVSHDEAKEYLEELERAGQDEFLEKIWPNIKEIFKSKKFSDDVKEV
ETTESTTEQKEPEVKPQPKRDNWAKHEYGDDDDEDEEEDDEELEDEDYDATTPPPPVEEV
PEDKMPDYDEETQKLIDAAEQARNEFNDADRKVKDTENEINTVRQYLDIDFGPEFEYGSL
KGQCFEMTDREYTYKLCPFDKASQRPKNGGSETSLGNWGHWSGSEADKYSAMKYEKGQNC
WSGPDRSVEVILQCGTENLLLSASEPSRCEYRFDFATPARCIDPATLQPSPKDTHDEL
Download sequence
Identical sequences V4AQL3
jgi|Lotgi1|226808|estExt_Genewise1Plus.C_sca_2050014 XP_009052188.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]