SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|228219|estExt_fgenesh2_pg.C_sca_20077 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|228219|estExt_fgenesh2_pg.C_sca_20077
Domain Number 1 Region: 19-97
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000837
Family Growth factor receptor domain 0.0034
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|228219|estExt_fgenesh2_pg.C_sca_20077
Domain Number - Region: 109-140
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0915
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|228219|estExt_fgenesh2_pg.C_sca_20077
Sequence length 146
Sequence
MQWLLLTILALATLGSVAALSCRQCQPDHECPALPNDGKCHPARRPCSCCDECAGLRGDD
CGPFTARCHPDLVCVNENGEEKETVQWHEKFKGVCKRSKAERAERACKRLNQLFRLFNST
NGRPGRFLRRWLKRLYKRCLAKYNVN
Download sequence
Identical sequences V4A172
XP_009051429.1.39240 jgi|Lotgi1|228219|estExt_fgenesh2_pg.C_sca_20077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]