SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|228560|estExt_fgenesh2_pg.C_sca_30152 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|228560|estExt_fgenesh2_pg.C_sca_30152
Domain Number 1 Region: 278-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000292
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 2 Region: 335-397
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000403
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 3 Region: 1127-1176
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000523
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 1020-1066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.03
Further Details:      
 
Domain Number 5 Region: 1072-1121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 871-972
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000489
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 7 Region: 981-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000643
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|228560|estExt_fgenesh2_pg.C_sca_30152
Domain Number - Region: 567-620
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000222
Family Complement control module/SCR domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|228560|estExt_fgenesh2_pg.C_sca_30152
Sequence length 1423
Sequence
MKRITEWFWMLVFYRITLLCLTETGARQTALDITMSMTRRYNTSVGCESINLGLMNCRFY
IEQTSSEILSNGKTTILPELTRCINTDSKRCLICLQSQWFVNSCSNLYSLPTLKCPELPK
RIFLNPGSSTANIVWKKSTVDGDSRLTTYNNSIKSGQNVTSGFYSLLYSAANTQGLTSVC
TTEFLVSDLSPPKISCFPPSNHIIPVDPVSLTAVATWDFPEAVDQSGTIIKPNSIHQVSS
NYYSGDVIPRGLHYFQYDVIDVNGASDSCSFTIDMRFVQCRALKPPVNGNITCNSTDFRQ
NTHCVYSCRPGYILHDFPLLTCLDTEIYDYPEPSCQVLQCPKPSQLSSDSYVSCSNSNNI
NSTCVVLCKPGYNLTSSTNTASCLPSGNWNTSFPSCTDSEPPVFLSCPQKNIFNHYNSRF
ENSIPAIWSVIIATDNSGEEITPGLTEGKDSGELFYPGVTKIQYRAVDSKGNEAFCQFYI
IMSVLASGCSAGTRFNENADTCVKCAVGFYQDAENALECKPCPGGFTTNSLGCSKIQDCK
YNERLLSREKRASTSCVEPVFNDPSILLKCTGYDMNDVCQLSCLSGRQPVGSNRIVCVFD
LKIGRFVWLSGSGEQPRCRPRGDLIGMLCTICKQFTPGANCCPVYDLKHTDWMPMDFSEI
KPQPPCEDFVPSSTGKSPVSIISGVKSFTLTCPVDMSLPRNTITAKCDLKTGVWDPAPWL
QECTNKYSPIKYRLEVTASYSGRSCSLPSVREQLRSKFTSLLHSAKVWKYHCPSSRQCSA
DDVMLLCSYYRRKRRDIRKRASTMYKTDIKWHFSIRMQEDEMKGEKVRLLKNVLFNMFFG
FAEDTYSGKFNQIVGFYFDYASLNMGEFTYVCDTGGIYDITTKACLVCSSGSMYDVNTDR
CIECTQGYYQDRDNSRTCFQCPPRTTTQYTGSKYHTQCQIQCSAGYFSANGFLPCLPCPS
RGTSSRGSTKCQHKRPLPRIQDFCANSSCVANNHTCQSVFDGYRCFCKHGYLGEECNITI
NPCTYLQCENGGACEASPGGKAVCKCHDGYTGALCQTKIEWIFIVNNDDLTSTWTEWVSW
GDCRTDSPGCGQGTQTRARICIKDVKGTYCHGADTDSRECNKIGCPVEPEWSDWSAWSSC
TSMCDGERQRTRKCSSPPFYLGPPLCKGGNLQSYPCSRDYPDRKCLKCSVTDLLIPSPMN
VSCSEIEGILTCIMGCQSNQVLYNKLTLNPAYTCNQGIWSPSTNVLPCTDFHQPLALSKM
ITASYRTNCTDTSKSSNLTAAISRNFDSIFNQVLVQSPQCTSDGLVVTVRIKTNIDKSVT
FTKASERLPVFSKYHRVFSINSSEELILPVNVAEISQLHCPDNTVAQGAYCVECPAGSYY
HLDECLLCPLGSYQPISGQCSCIRCPFRTTTHYLGSRSLLECR
Download sequence
Identical sequences V4AF52
jgi|Lotgi1|228560|estExt_fgenesh2_pg.C_sca_30152 XP_009055411.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]