SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|228850|estExt_fgenesh2_pg.C_sca_40327 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|228850|estExt_fgenesh2_pg.C_sca_40327
Domain Number 1 Region: 2639-2663,2789-2843,2999-3018
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000863
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|228850|estExt_fgenesh2_pg.C_sca_40327
Domain Number - Region: 1554-1576,1628-1756
Classification Level Classification E-value
Superfamily Sialidases 0.000126
Family Sialidases (neuraminidases) 0.032
Further Details:      
 
Domain Number - Region: 1739-1818,1902-1949,2044-2119,2281-2312,2347-2365,2439-2484
Classification Level Classification E-value
Superfamily Sialidases 0.000149
Family Sialidases (neuraminidases) 0.054
Further Details:      
 
Domain Number - Region: 1792-1817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 2527-2554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.058
Further Details:      
 
Domain Number - Region: 1190-1218,1272-1297,1348-1391
Classification Level Classification E-value
Superfamily Sialidases 0.00265
Family Sialidases (neuraminidases) 0.038
Further Details:      
 
Domain Number - Region: 3252-3275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 1079-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00471
Family Integrin beta EGF-like domains 0.096
Further Details:      
 
Domain Number - Region: 960-1045,1173-1213
Classification Level Classification E-value
Superfamily Sialidases 0.0203
Family Sialidases (neuraminidases) 0.031
Further Details:      
 
Domain Number - Region: 2878-2903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.022
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|228850|estExt_fgenesh2_pg.C_sca_40327
Sequence length 3454
Sequence
MAPFFFLCNYHGNIQEMGVEKGEVALSVSVKGNPEFYVPGQFYEITVTSSMNFNGFFLTG
LYSIADKAMGGMYPNQQYVQGNQPVGQNLMCSIVHSHINYLPTHQLSFIWIAPNAGMGCV
TFLATANLQQQLLFKDTVVLQLCEEGDAQDKSLRPQLAELNSDLVILRDDFDSSVNFKPD
LWRTVEGGDISDKCGVVLHGKSAVFCDTVGKRVMTTMPLNTTSAKILQFSVSAGSCGNNI
SRDNDIVISYSDSGCTQFIPIQTIRPPLTSDTEVHMIHLPLESRGEGVCLQWLQLSLSTT
TTTTTTIATTTTKQPHTTSTTQSTIVQTSRKPPSQRPPFYIPIRFPADQPYAPYSGRKTK
TSGRKLLQDDSYNQDYDSCWAIDNIVIVNTANPPTVLEDDFDPVDPGNWLFFPGANIQPK
CHSDNNAIYFNDGNQTYNYVVSRDIDLSPTDILYDSILTEHFESKTQSGWYIVGGHVDVT
CGEIRYGNSMVFDYDGKRLMCTPYIDTTVADNLQFYIGVVYLIGSGNCGGNGDIPEKAKI
VIYIKDRNGQTQIVDTLEPPRFHEPSLVSVKIPNSGSSKICWIQKYHRGAGFDSWAIDNV
IILPELPVQSSPNSNKILQFKLNLQCGINVQHNSLQLEYSTNHGLDWLPLYTPCLPSTCH
GTYLPYQSLFTSSQLSGWNRLTLPVPYQAQVPHVRFRWQQLQDSGEPNWAIDDVYIGDCE
AGCNGHGSCHQDGCDCDFGYHGIFCEDSIVPNPTSLLENFENNLIVQSSQLLSIEGGEIG
YNCGVISSGKALVFDNSGPRQVETTYLNTTEAVYLQFSIRVGSISMTSKCPPPSLSESVI
LEVSCTGGVYWHYLREFSSEYFKQPMMDSVQLPDFSKGESCKFRWRQLHHSGQGQDVWAI
DDVSLSQEMTNTLLIDVSDMKDMRDDLTAHLGKLVDSYCGAPKSITFSGKEKVNESRYLM
TESLNVGPSQMIQFDITMGCGVPYSKNRDNQLYLEYSSDHGIYWNLVYDSCLPPAICETY
KPGTVYHYSQYSHWTKVNIILPPDTWSPHTRFRWIQPEWGPNDAWAIRRFYVGQQCPDMC
NGHGACEQGFCKCDKGYIDKNCQSASPRESIIHADFGMRYEPEKDFIQIIGGDIAKVGEG
CGVIVSGESMYFYKDGVRELQTKDLNTTVDDFIQFYIRLGGNDKLCNGGDKRTESVLLQY
SNNGGNTWTILEEIHFTEFKQPRFVFVELPEQSKTTSTRFRWWQPEHSGEQNDQWAIDEI
YIGPHERLPQLHDDFDASPDPFDSGQWLMVTEGINSKYCQSSMPVMVLGNQFNDKYAITK
DLQLKMGDIIQFKINVGCGHRFRWNYPVMFQYSQDNGMSWNLVQEPCYQQEDCDGDYTEG
SLYYPGTHGEWTLVVIPVSSKIAQHPVLFRWWQPGDMTHSFALDDVYIGPSCDKHCHRRG
VCVNQQCQCDQQSADINCQSDEANPKGMLDRFDNRNQPTAYWNQITGGYLGRGCGVVDFA
NSLYFNGPGTREARSDPLDTSSLRMIQFVIKIGGERNQKGCRQPQNRNEGIIVDYSVDNG
ISWNILKVIEPKVFNSTTQVVQVELPKDSKTNQTIFRWWQPLGHGGMPRAEWAIDSVLIG
VNDSNTIGFQDEFNMMMPDPHTWFLADSAVPRITCNSKGNALEFSTNSGLRYAETWDYHV
TPSTFLQFEIAMGCGSLYGTLYSVMLEYSVNMGKTWHPVVSECMPPNFECSGYHLSSEYS
SDQHTNWTRVTVYLPPGAVSPATRFRWLQHTSHPRGTVWALDNVYLGEGCPWMCSGHGYC
NKGKCICDKGYDGDYCVPTVPLPMMLRDDFRSSEINRNNWREIYGGESTDICGHLVDGNS
LTFHKNSLRMGVTKDIDTSMLNTIEFYFRYGCKGKESDWPRTHSVLLQYSSNGGITWKLL
QELHYRNETGKRFFSINLPMSARMNSTRFRFWQPMNDGEMQRTWSIDNLFIGTMTNNPSL
LQDDFTRDNGDNDNWLFINGGEIGGYCQFNSLPSTNESGISSLVFRNNGKSEKSVVTRDL
NIGPMSVLQFDINVGCGSQSTEKYPILLQYTSDGGKSWHLLVENCAEISESQCFDSKIPA
TIYYGGTTSNWKRVIVPVDNIHLCGSVRFRWYQGNIPEYDYGPEWAIDNVFIGMSCLSHC
NGHGRCNEYMMCDCDEGYEGMFCEPVQANPTYLKEDFGLPVLLPYPFRGDLPLGPLNDAP
SELDGKKWAVWSNVDVSTKCGLVFTGPSLYMNNNGERILQTKELNLVTVSSVEFYLQQGC
HHPTNPASPIYLQYTTDGGIHWTTIEQFDFHIHGHISKYIAIHLPPGARTQSTQIRWWQP
SIDGTFAETWSIDQIYIGGDIYRDQVLQDQPMVPEDSSWLMFPGGIVESVCDSPFLALHF
KEKEKMRYAISADVSIKEGTYLQFYLAMGCQQHNQCFSIRVEFSFDMGKSWSLLQPACVP
SDIDCNSYFTSTVYSSDIYYNWTRITIPIPYYVRSKSTRFRWLQPDDFNPSNTWALSHLY
IGNGCTQMCHGHGRCSNDSCICDEGWSGISCNISTSPLPDILIDDFNVESTKNWINIVGG
EIVTPCYNLASGKVLHFIGDCNRVLITRDLDLHNSMFIQFYFMFGCNMPPLSRNESVLLD
YSINGGITWSPIIELYYNLYTSPSFISLRIPQAAKATSTRLRWWQPQHQGPQLSDWLIDS
IRINGEEINPKQFKMNNSDPLNPKDFTTFDHMSAGEYCKELNAIKGTTVNNEPSSLVTRE
ITLNKGYMLQFMINVGCDIPSNVSVSPVHLQYSTDHGLTWKYLMPQCLPNDPHCTTGVSM
PTIYYSSPDYEWQRVILPLHGLPVSNGTRFQWIQPYEGQSVPSTWAIKDIYIGPACPNYC
NGHGYCDYPTCICYSGYGRDACQSILYQNNPTYLKDTFDKVAVNRSKWSSVQSGSVGIGC
DTLVEKTALVFNGTGLRQAVTVDLDLRNARFIQYTAMIGGEGQESGCFIPNSRDQSIILQ
FSTDGGISWKTLYTLDYLSYVQARHDYIDLPEQAKTASTRIRWWQPLPTVPNRDRPNWAL
DNVFIGGSEINPSVFQQSFNDSKPQNDAGTNWEFSPYASMKNDMCARNDNVVSWEEGKGN
RLFTTNQLIVQSGYMLQFKIVVGCNKVYNVCDDNKPVRLEFNKNPMSTAWNLVRTLCGPD
SSNKMECRSQHQHDASIYSVSSHPSWTRITMKLPEKVFSSSTRLRWRQEGIQSPAPGWSL
DDIYVGEACPDMCNGRGDCKYGHCVCDKNYIGKTCVPIKSRLPSRMFESFEGGIFPSHWY
KITGGGIGFGCGALLPYAHGKTLYFNDCGIRQAITAEFNLQSASKIIFVLQIGCNAQTHN
CNVQLGEGSDFRGVLLQYSLNKGADWKLLARHDPEKFLKPKRMAYDIPSDGKKVGVQFRW
WQPVHDGKGFDQWAIDHIEIVRSRNHYNKKHRRG
Download sequence
Identical sequences V4BRE4
jgi|Lotgi1|228850|estExt_fgenesh2_pg.C_sca_40327 XP_009058123.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]