SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|229373|estExt_fgenesh2_pg.C_sca_60270 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|229373|estExt_fgenesh2_pg.C_sca_60270
Domain Number 1 Region: 174-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 30-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-25
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 3 Region: 462-570
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-19
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 4 Region: 315-436
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-17
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 5 Region: 579-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-16
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|229373|estExt_fgenesh2_pg.C_sca_60270
Domain Number - Region: 706-739
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00301
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|229373|estExt_fgenesh2_pg.C_sca_60270
Sequence length 840
Sequence
MTENSHSISFPMKSSQFCEHIISSEYKNASKNGSFQSPGWPNHYPNSVHCTYKFVGRENE
RIRIKFSQFSIQGRSPICDHDYLDIFSQLTFHSEDLLEAELTGRFCGELSDSLPKLIVSR
NNVLVLSFFSDASKNYKGFNGTYEFFDASVYDIGTLAPPMSCGYTVRSESRTKGYIISPT
YPGMYPDNLFCYYKFHGKPGQRLKLTFVDFSLFHGDEYCPFDYLKIYDGYTSDSPEIGTF
CGKYNKTTLYSTSEALHLEFVTSQGRLEFGKAPLEAEADFSFDRRGFNITYEFSDKFVNL
DFIEKDAEHILGTECDQRILSRKESNGTISSPNYPEAFPQNVTCRYYLDGLMDRQNLEKA
RISFFDFNIPGNMPYCMIGYVGLNDDRRYGKGEVKEKFCGSLLPPALSSTGPRLVLTLNT
HGAVRGGRFFARYQFVTDYAISGLPIAEGQCSYLYTSSKQKAGSFNSPRYPGHYPEDLEC
VYIFRPEDDWKVLISFDVFSLPATDSTQCLNTDFVEISEETDIRNNFTVVGKYCANNYPG
PLLSHRVVKMKFHSDSQENTMGFKATFQFVKGVDMNTKCGRIIQSPGTGGVIESPNYPRK
YKANTYCEWEIRASKKHNRIMIQPAYFNIEKSADGCSNTAVRIYLEENSLQPHIEMCGSA
DSNFVNISHKDVIKISFISSQKALGGQGFKLSWTEIYSGESSSCFGFKCKSNKHCISSTL
SCNDLPNCGGGDNSDEVTECPVAAGIQILHIAIGTSISSFFCIILLICGFYHRRKFRNEP
PPDDHDHVEVRNSNSTHRSSNSNHRTSNHIPMMSNHNHRTSNHIPMISNHNHRTSNHDQD
Download sequence
Identical sequences V3ZSC7
XP_009062223.1.39240 jgi|Lotgi1|229373|estExt_fgenesh2_pg.C_sca_60270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]