SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|230036|estExt_fgenesh2_pg.C_sca_100261 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|230036|estExt_fgenesh2_pg.C_sca_100261
Domain Number 1 Region: 195-308
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000379
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 2 Region: 305-422
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000144
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 3 Region: 418-454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 73-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000471
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|230036|estExt_fgenesh2_pg.C_sca_100261
Domain Number - Region: 7-57
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00523
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|230036|estExt_fgenesh2_pg.C_sca_100261
Sequence length 520
Sequence
MPISNLQVEVNLTQTDISGFIEFYDGFLPDSQLITTFSSKSSFYPVTSPGSNLLIVARNF
TTESVPGSFISVIDSCNVVTSENKGSYSLSSLAVNQTQCQWTISPHNKDGVISLEFKTIS
LRAKDSLTISGISNITNVLAKFTGPTDVSFIPNVDISASKIIQLVFETTNNCSVNCTEPS
VVADYTQNDACIGQLQHPSGVLTSPKWPNVYPVNAQCLWADTETVNDTRMLYMSFEKFNL
PNNHSLELMSGFQEAWNINKKFTGNTLPNDIIVKGDNYQLIFNSQQTSTHLTAEVGQGFQ
ANYRFLDCGGFIANESSVIQSPKSTNMSDVCVWIIQLPADPKIKNISVINFELVVKNSSS
KNNLSNSVTIHDGGSIRAPVLLTNNSQNSTQIMSRTDTLLIMYNMSGSSNTSFTFNYTRY
VCKYLCKNGVCLQPSWRCNQIDECGDNTDEQNCVYPFPPTTTPSPSKGGGNSGVASYWVV
LCLLFGIIMGVLFAIFVPRIYKRMRFQNYSTLRESNNPIV
Download sequence
Identical sequences V4CR75
jgi|Lotgi1|230036|estExt_fgenesh2_pg.C_sca_100261 XP_009044494.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]