SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|231078|estExt_fgenesh2_pg.C_sca_170184 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|231078|estExt_fgenesh2_pg.C_sca_170184
Domain Number 1 Region: 388-509
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 261-390
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000659
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|231078|estExt_fgenesh2_pg.C_sca_170184
Domain Number - Region: 67-165
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00602
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 
Domain Number - Region: 472-507,556-648
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0102
Family Growth factor receptor domain 0.0047
Further Details:      
 
Domain Number - Region: 1590-1620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 970-1084
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.0032
Further Details:      
 
Domain Number - Region: 1252-1288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Laminin-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|231078|estExt_fgenesh2_pg.C_sca_170184
Sequence length 1639
Sequence
MPTVLTKEGDHNDRYSYNSQPLSGGYLDQYKPDRYYFGRHRNKLLTAGIGYHDNYNRIPL
NHQNSIIDANQPRYPYNQPRYPYNQPNYYNQPNYQVDYGMKTQYIPTNNRVQYGASNTRF
GTDVDLTRQRGQNPTSDRSRILYGRHPAPRPLQTAAPTRAPTPPTSAPYNKVQSVDNGQY
KFQNGGYPTPSPRVITPKPTPVSDNGNPLYGSELEGPEIKDVERTTSAPTGNHLNVLRPP
FRISSKPRLAILDMKVKATGGCSVRNGGCEHVCVDGYSGRFHCRCRSGFTLGRDGKSCET
TNPCNGNIGCQHKCVNDRGRAICQCFKGYRLSRDRRTCEDVDECQRDNGQCSQACVNTKG
SFVCTCTPEYQLGEDGKSCYRIEMEVIDNCAFNKGGCAHKCRNGVNGPVCSCRKGYLLQA
DERSCEDIDECEGGDHCCDQYCNNNPGGYTCSCSRGFLLNRDGCGCEDIDECLNDNGGCE
QICVNSEGSYSCACTAGYTVSPDGRRCIADEPIDKGPERGDLPRIRYETTPLPILSITED
PYDSLLSQELQEQAAKFNCQPGTFGVNCLLNCNNCLNGAICNEEQTGCECTAGWQGIICN
ETCSQNFYGKDCNSICNCPNGNVCDSVTGECKDECPQGYYGAQCNRRCPHHCASGHCHKV
FGYCKCRPGRFGPSCNQPCPSFTWGSNCATQCDCNVDNSNGCQPETGECVCKPGYFGEKC
LDRCPADRFGEMCTRICDCPADSKCNHITGYCLKECPAGKTGQRCEESCPNGKYGPNCLK
KCHCSGSSCHPESGKCVCKAGKTGRRCRKSCPLGSWGMDCANKCTCKNGAKCDSITGECV
CKDGWYGPYCGEACPSGRFGPQCMEVCMCENNATCDQITGDCTCSPGWTGQLCDRGFPPG
RWGRWGSDCQSKCQCLNSADCDSITGECICVPGWRGAGCDKKCLNGTYGAGCLKKCKCQN
GATCDHVGGACTCSDGWRGRFCEKACPQGFYGLDCQNICNCGNGATCDHVTGDCHCESGW
YGDSCEQRCPAGKFGDDCGERCQCVNGDCDTVSGNCICSAGWRGAKCDEVCPPGFYGNSC
LYRCFCLNQGKCNHIDGSCNCTAGWEGTACESACPSGKHGKNCDLDCDCVNGKTCDRVTG
ACVCNPGFIGPRCNKTCPRGFYGAECNSMCPCKNGAKCNSESGECTCTTGWRGKNCDKPC
LPGLYGDDCNQKCSCDKDEPCNHLNGECRCPPGFSGPSCGQHCPHGTFGPECRGQCSCNE
NYDCHHVTGECVCKPGQRGRMCTQARKGGKLRKGRKGRKGKGKWRKKPKDKNGFKKLQAG
CKEGEFGPNCDQLCKCENGGECDMMTGSCMCPPGFIGPTCSERCPGNTYGEDCTGVCKCR
NGGKCSRRSGRCKCLPGFKGKHCDEVCEEGKFGMECKENCNCKNGRCDPVSGLCDCNLGW
MGGACDLPCPPNRYGPGCNHTCMCQNGGECESVTGCCTCPDGYYGHVCEMVCPQGTHGPY
CQETCDCVNGATCDARMGQCRCPPGYKGDTCQKRCPSGYFGVNCLQRCDCENSDCHHVTG
KCICPPGYSGRRCDQKCSEGRYGPSCAFFCDCDNSGICDPVSGSCSCEKGWIGATCQVVQ
IPSGPRRGDVPWAVNYSRK
Download sequence
Identical sequences V4B093
jgi|Lotgi1|231078|estExt_fgenesh2_pg.C_sca_170184 XP_009049938.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]