SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|231159|estExt_fgenesh2_pg.C_sca_180056 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|231159|estExt_fgenesh2_pg.C_sca_180056
Domain Number 1 Region: 43-274
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-33
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 2 Region: 306-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000277
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|231159|estExt_fgenesh2_pg.C_sca_180056
Sequence length 351
Sequence
MKYISLIPVFLCFLNSITSITFPSTEDGPQIAVLEFKKVMKVFDPEASEQVESISLRGRG
GTACLDFNYRNNEIYFTDLFSNQLIKLKADGGEQNQKIIFDYEARASPEGIGYDWIHNNL
YLCLWGDDHIDVLKSDTGEKITLINTTKPRDIEVDPRSGWMYYIAGWEETARLVRCGLDG
QNEEVLTTDIERPFSLSLDYSENKLYWTEKYPVNKLYSIDLNGENKREFLHTSYSYDLSP
SYLTVSREYVYWTAGYKSRVYRRLKHGGTQSQRYNNLEEFGNYNIRTNLFMGILAVDPQK
QPETASLCGDNNGGCSHFCLPSPVDLHLSPSFTCHCPDDMELTDDNKTCNQ
Download sequence
Identical sequences V4AUW3
jgi|Lotgi1|231159|estExt_fgenesh2_pg.C_sca_180056 XP_009050397.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]