SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|231422|estExt_fgenesh2_pg.C_sca_190197 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|231422|estExt_fgenesh2_pg.C_sca_190197
Domain Number 1 Region: 464-520
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000034
Family Tachycitin 0.021
Further Details:      
 
Domain Number 2 Region: 290-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000876
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 3 Region: 345-404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000742
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 4 Region: 407-467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000836
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|231422|estExt_fgenesh2_pg.C_sca_190197
Sequence length 523
Sequence
MTGLFPFFLLAIVVGIESFSLVKEDNSIIDVTVDCGANQAANSAVLNILTDVDISAIAKC
KNGEKSFITTDSVHYTLPATLTTRDNLCELNEKDGSDNFDIEVEVHYGELDGLILTKTKL
VTVVCTYSDHGKDDSGQHSIRDGPQAYIEKQTFVGASVPKADLSLSIQTVDDQDAVGSIA
FDRRYSLFGSYTGAQQNVGLKPVSCDAISDDGERYAVLTAGCGDGFIFDRADGFVTTGKT
FRSPYFFAFHLANSGNLAFDCNVTLCSPNCEGTSCETVCGPVTSFVIPNIQLEQCTGNNK
YQDTCSFICNDGYDKSGVAISTCGADGIWTVPDITCPPKDCGAVLPEGTMSTGNAASGTT
YPNVADYTCNEGYTTSTGKAQIQCLTTGKWDAASVLNCVARDCGAILPEGTMSTGNAASG
TTYPNVADYTCNEGYTVLSGKAQVQCLATGKWDAASVLNCEIEDSCDPVNRDPVPDPKDC
KKFKQCSEAGIYLSMRCPDGLGFDEKLKVCNYFTEIPDCDEQN
Download sequence
Identical sequences V4C9E4
jgi|Lotgi1|231422|estExt_fgenesh2_pg.C_sca_190197 XP_009051055.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]