SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|232137|estExt_fgenesh2_pg.C_sca_260044 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|232137|estExt_fgenesh2_pg.C_sca_260044
Domain Number 1 Region: 10-118
Classification Level Classification E-value
Superfamily Prefoldin 7.59e-21
Family Prefoldin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|232137|estExt_fgenesh2_pg.C_sca_260044
Sequence length 437
Sequence
MDATHLARLREEQDKAIVETDERITQWEEMKSSYVSLQDKLNSLSHQVSHDVMVPFGPCA
FMPGKIVHTNEILVLLGDNWFVERSAKQAAEIAGRRIDSIEKSIKDLSEQKKLLQPRVDI
TSEFQHLAEEKDGIKEIVEDYDSDEDKKWREKHKKSVQAHRRKLHEDRKQSESKSELKSE
LTRDELWERLDELEQIENSRQELKRLKPEQPFVHSQPDFKDVFPSQTTKSPDQSISKSSK
KAVDIPLQETNKDNKRLPSKRIQWEDEDSEDNTDDSYDEDSSDDTSTSNQNDSEPRHVKR
ITFSHSSQSLNKQNSSSSNDIEEESREGSADRPPDIASPADIYKHFGQLTQPKSILKQSS
CKKQAVRKAREAEIEESRSKSSVKKMSDTAFSGAILEKPSISSTQSIVSMPKPVNTSQSS
QRPMSKFRAARQKQNES
Download sequence
Identical sequences V4AN11
jgi|Lotgi1|232137|estExt_fgenesh2_pg.C_sca_260044 XP_009054198.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]