SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|232182|estExt_fgenesh2_pg.C_sca_260127 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|232182|estExt_fgenesh2_pg.C_sca_260127
Domain Number 1 Region: 41-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-18
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 2 Region: 145-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|232182|estExt_fgenesh2_pg.C_sca_260127
Sequence length 286
Sequence
MESYLKWSVIIGLFGFCYSIDTQYMNEACNGSSVIDTTLLLETSKSLSYPPLMNCFHRVN
VASGFKVHVSVERFELEEKMANACVDYLILYDGADQNAPILNSEVTCGKTAPENVTSSSN
ILTFYFKSDHSSALRGFAFVVTPVTDVPCSSSQLQCNNSLCIDASLKCDSYNQCGDKTDE
NDCQVIGSSKIDDSNTTLIIGLVIGITILIAIIIAIVINVYKNNKWKRFLNQHLEDPDVW
NASPSYPVTQKYFTSGRGNYNTLSNENYNEVTLQPHSEESIHNSEI
Download sequence
Identical sequences V4C0U3
XP_009054269.1.39240 jgi|Lotgi1|232182|estExt_fgenesh2_pg.C_sca_260127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]