SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|232356|estExt_fgenesh2_pg.C_sca_280103 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|232356|estExt_fgenesh2_pg.C_sca_280103
Domain Number 1 Region: 2179-2323
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 1032-1160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.43e-18
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 958-1024
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-18
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 4 Region: 403-546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.21e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 718-861
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 1822-1956
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 536-666
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 2513-2643
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 2118-2186
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.35e-16
Family TB module/8-cys domain 0.00021
Further Details:      
 
Domain Number 10 Region: 2398-2470
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-16
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 11 Region: 1416-1549
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000013
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 12 Region: 1948-2074
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000137
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 13 Region: 2288-2408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000424
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 14 Region: 655-727
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000589
Family TB module/8-cys domain 0.00059
Further Details:      
 
Domain Number 15 Region: 1746-1817
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000916
Family TB module/8-cys domain 0.00066
Further Details:      
 
Domain Number 16 Region: 170-255
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000165
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 17 Region: 1294-1420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000471
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 18 Region: 318-371,410-430
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000111
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 19 Region: 852-934
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000017
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 20 Region: 1581-1660
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000942
Family TB module/8-cys domain 0.00021
Further Details:      
 
Domain Number 21 Region: 2469-2517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 22 Region: 1198-1246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000012
Family EGF-type module 0.01
Further Details:      
 
Domain Number 23 Region: 2080-2123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 24 Region: 275-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0025
Further Details:      
 
Domain Number 25 Region: 1665-1719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000706
Family EGF-type module 0.004
Further Details:      
 
Domain Number 26 Region: 1539-1586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 27 Region: 1152-1200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000352
Family EGF-type module 0.0074
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|232356|estExt_fgenesh2_pg.C_sca_280103
Domain Number - Region: 1709-1741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000963
Family EGF-type module 0.0047
Further Details:      
 
Domain Number - Region: 2649-2700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00319
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 2690-2723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0115
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 140-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|232356|estExt_fgenesh2_pg.C_sca_280103
Sequence length 2945
Sequence
MCILLGYRNTLLSVFILVSVVLLTNAARGRQRTHRSFLQRDQPRGPNVCGSRFRRVCCSG
WLRPRGSRHCNIQLNLKTNDVQRPDMQNSSSSHMLISYRQRSSKCSGGCNGGRCMKPNLC
FCPNRQISRTCSSRDKSTVKCTQGCENGGRCTGAERCSCPYGFSGNRCEQDYRTGPCFTQ
ISNNMCRGQLTGVVCTKILCCSTIGIAWGQPCEQCPAQRHPCRRGYIPNPQTNSCQDVNE
CEAIPGLCVGGNCVNTQGSYRCGCKEGQIQNPVTQVCEDINECRLNPGICRVGTCTNTEG
SYFCTCPPGFETSPDRSRCTSIRRGFCYRSVVGSNCRNRIQEQTSLKDCCCTIGKGWGQG
QVCQPCPLKGQDIDMEEVNPNVLRLGCISLINVNWKDAWERLCRSTEPLTEFVDECSIFD
KLCQNGRCIDTPDSFRCECNPGFKSNAAGNCIDIDECLLPGTCNNGRCVNTPGSFTCRCP
DGFTLDKSGLFCSDMDECKKDGMCPNGICINMDGSYKCQCKPGYRQSSNRQICYDLNECT
ENGRLCVNGECRNTEGSYYCECNPGYKLSPDGAFCSDYDECRTTGMCTNGMCINMDGSFK
CICKVGFTLAPGGEVCIDINECIVNRDSCVNGQCINNQGSFRCDCADGFTLGPDGRTCLD
TKRDFCFPEIRSGRCVNPVEATVTKSVCCCSMVRPGVAWGLACDRCPSMNDPDYKLLCPN
GNGMDHDGKDINECIMFPGICENGNCENVKGDYRCICNNGYEITRGGKKCRDINECERDR
SICDGGKCRNTPGSYRCICPPGLIFDSTSRMCVDVNECRENPCIKGQCINVAGSFKCKCL
TPGTILDPTGRICLDNKRGACWRTIKNGVCEDNIESMLLKGECCGSIGKAWGSPCVPCPT
QSELACPRGYANRLGLNCVDINECELFPGICEGGGTCVNLEGSFKCTCDFGLTLDPTGLR
CVDMRRDRCYQDYNRGFCVRPLMGAYLRSDCCCSIGGAWGDPCEPCPTRQTDAYEKLCSM
IPGREGTIPGVEINECMMFPGLCMNGRCRDTIGSFQCTCDSGFALDDMGTNCTDIDECRI
SLTGVCANGQCENTLGGFRCICDPGYEGVMMDTMCMDINECDQDSTLCRGGACVNTPGSY
RCDCPDGHQLSEDGLSCTDVDECGTDSSICSNGHCVNFMGGYQCICSQGFVPNELKTTCI
DADECRDRNGGCADRCINTPGSFNCACENGYTLMIDGRTCIEWSPVRSCPVPSRIPDRRI
IRNISVVERDTGVIYLVASGYPIVTGFVFFHSVDIDECKDRDTCKGGKCINQPGTYRCSC
DGGLTMSIDQQQCLDIDECFLNRNLCLSGYCQNTHGSFICKCENGFGVDGKDNNAGCTDI
DECVTGESACDENSRCINTKGSYKCDCLPGFTGDGYTCRDINECVRDNGGCNRDATCVNG
PGSFRCVCDDGFNGDGFECRDVDECSVDPNLCENGQCMNFPGLFRCECDMGFAPTEDERA
CVDINECDMFHNLCVNGRCENVFGMFRCICNQGYQLDFTGGNCTDIDECLNPDNCQYGTC
INRRGSYVCQCSANYELNPTGTGCVDKRRGTCYMTAPFSTRGRLGVCRDEIASNVARATC
CCSVGRGWGDVPGFCEDCPRNGTSEYNSLCPGGPGFRPNTLTLVLEDINECEEIDDLCKG
GDCQNMFGSYICVCPPGYHLDGTMHKCVDIDECQVDAALCGRGTCINREGNYTCICPEGY
MPMDGGRDCMDMRKEGCFMEYLNTTRRPYRTICENQISSNLTKRQCCCTVGAAWGNRCEI
CPRERSLQYKVLCESGAPDIKGDVNECELIPNLCENGRCINTIGSFRCECYRGFNYNANL
HICEDENECRRSLPPCMGNSVCTNTPGSYQCSCPDGYKLTSDRRRCQDINECEELPGVCA
NGNCLNLIGSFSCICRDGFRLSPKRDSCIDVNECTSRPGMCRNGTCKNKMGDYVCLCDPG
FERTSRGDCVDIDECRTMLGICLNGRCANKIGSFTCMCQEGYVLSNDGLNCRDIDECSTR
RGICRHGTCQNSEGSFFCTCFDGYKLDRSRDRCIGNVPPPNVDECRVIPGLCFNGRCQNT
AGSFRCMCPAGFVLTTDGRECRDMRKGNCYRRFENGRCLEPRPVNTTRDQCCCTKGEAWG
GYNCEICPSEGDPGFRHLCPEGYGYVKIMPGEIMSDVNECLIHRGICEDGVCVNTDGSFR
CECRPGYTLDITGTKCVDANECIDRNMCGNGTCTNMIGGFECDCRPGFTPGTSGKCEDVN
ECVTSANQCAFRCVNIPGSFKCVCPMGYKIAADNIHCEDVDECLTRTNRCKYACKNIMGS
FLCVCPEGYRSVGADECQDIDECRATPGLCTNGRCRNTQGGYRCDCNRGYDLSPDGKRCF
DGRSGYCYPTLLNNRCERTRTSQIATKSECCCGLAAAWGPRCERCPRMGTVGFKQLCPSG
PGFTPDGKDIDECIGMPGACTNGRCFNTMGSYRCVCNPGYKADPSGKMCTDIDECALVPP
KCDGNCRNTIGSFICSCEKGYSLSIDGHTCQDVDECLMNLHNCRNVKCINTVGGFDCECP
EGYRRGSTGNCEDIDECFEKVDLCSPGTCRNTPGGFKCICPRGYRLDKTGQKCLDLDECV
YDLDECVYDENECADEYLCGFAICINLPGSFDCECSGSGVYDFEHGSCENVNACGGSPCL
FTCSASLNGFQCGCPSGFQPMGPGHCISTITPPVGGGIPTYPGGVQLPHVPAPEGKLPGG
EGCYHCDKDFGDIPLSKRNRRSTEEEDDDLNMLINKHYIKQRAEKYSRTKRDTLKREHLK
RHREMSGNTTRQATPIHSQNSTEGPLELIIDRKQTRPKARVLKVLPSLTALNNNVRYKII
KGNVDGLFSMHKKKGISSLHFTRRLHKSTVFNLDILCSPIISDLDIDETFVHLQSFVIHL
KIRVQ
Download sequence
Identical sequences V4BZF3
XP_009054809.1.39240 jgi|Lotgi1|232356|estExt_fgenesh2_pg.C_sca_280103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]