SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|232671|estExt_fgenesh2_pg.C_sca_310003 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|232671|estExt_fgenesh2_pg.C_sca_310003
Domain Number - Region: 83-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00761
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|232671|estExt_fgenesh2_pg.C_sca_310003
Sequence length 222
Sequence
MSHVNYIVLLLVMIVHVNCQILPSNIGTIKADLEKGGRAVCKYCYGCMFTGLCGASCSGN
TMCELCSFKTHCDTTCVGLCQQPDPCATSPCPDNKICQELTNGGRAYRCVCQEGKVCEKT
TNSWETQSIFAKWNPTKRVTQEITNRPTTEKIITTPSPTTSRTQEYPTRQPSDKNLLTSR
NPFLAGTLTSPSLTSPVDNSQHNHGTAKPSYSTTGLPGYWFY
Download sequence
Identical sequences V3ZP81
XP_009055914.1.39240 jgi|Lotgi1|232671|estExt_fgenesh2_pg.C_sca_310003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]