SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|232797|estExt_fgenesh2_pg.C_sca_320064 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|232797|estExt_fgenesh2_pg.C_sca_320064
Domain Number 1 Region: 12-87,192-314,373-576
Classification Level Classification E-value
Superfamily L domain-like 2.53e-55
Family Ngr ectodomain-like 0.00051
Further Details:      
 
Domain Number 2 Region: 1047-1237
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-37
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 619-797
Classification Level Classification E-value
Superfamily L domain-like 5.53e-34
Family Ngr ectodomain-like 0.00038
Further Details:      
 
Domain Number 4 Region: 966-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 888-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000249
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 6 Region: 808-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 849-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000499
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 929-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|232797|estExt_fgenesh2_pg.C_sca_320064
Domain Number - Region: 1238-1277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000661
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|232797|estExt_fgenesh2_pg.C_sca_320064
Sequence length 1351
Sequence
MTQTLQIKTNPDLSYNKIQFIGKKTLKSSLKLKNLQLDHNEITCVSDQAIRGLHEMEILT
LSNNNITTLPKDVFSVMSKLRVLRISENKLVCDCHLAWLARWLRNQPTLALFTECANPPH
LKNKELAELQESDFKCIDGIRDHHHNQNCIVDNLCPHKCTCTEGVIDCRNKGLSQIPDNI
PETATEIRMEQNHITQIPSRIFEDMKKLRRIDFSNNQISYLAPDAFSGLHSLSSLVLYGN
KITDLPPGVFNGLYKLQLLLLNANRIVCVRVDAFKDLQSLNLLSLYDNKIQSLANGTFTP
LKNIQTLHLARNPFICDCNLYWLAKYLQLNPIETSGARCESPRRMSRKKIGTVKPNKFKC
KGAEVHRTVNAGTCMIDRECPEQCTCVGTIVDCSGRDLKEIPDFLPMYTTELKLGNNGIT
KIKADGLFTKLSNLQVLELNDNKIEMIEDGTFIGASKLTDLQLTNNRLTQLSGKVFTGLE
NVKTLMIRGNKVTCINNSTFTETPRLRLLSIYDNQIRCIMKGSFDRLYYLSTLNLMANPF
NCNCHLGWLSNWLKQRNVITGTPTCFAPHALKNTPIQDLKDKDFVCEENNEIGCNVGPAC
CHDSNMLTEENSCDPRAYCPPKCTCKGTVVRCSRKGLTEIPKYIPLDTTELYLDVNEITR
IPEEIGLLTKLNRLDLSHNKLLTLQESVFGNLTNLNTLILSYNELQCVAPSSFKSLKNLR
ILSLHKNNISSIPYGSFKDLVSLDHIALGGNPLHCDCNLKWLSDWIKDDFIEPGIALCVG
PPQMKDKLLLTTESKYFECLESLDPKVTEKCNVCLNNPCSNGGTCHTVEFKNFTCECTTA
FHGERCERQIDACFGNPCNNGGNCEVLEHGRFRCHCLDGFKGDRCETNIDDCVQNKCQNG
ATCVDEIMSYSCHCTQAFTGKRCENKIPFCKEGYNYCHNGATCVSMNTDYRCDCQPGFSG
KNCSQNVDDCKSHVCQNGATCVDGLNTYACMCPSGYSGQHCEIAPVVPIYNFWNPNKQMS
GACKNHDCQNNAVCFMPRGATESTDYQCRCAPGFDGKKCEKLASVSFKHKDSYIQLPNVD
FRKGVNITIVFKTESSTGILLYAGQDQHVAVELFRGRVRVSFDVGNYPVSTMFSYKRVDN
GHLHSLEMLIKQKNFTMKIDHDGFPRTVVNQGPQDYLEVDDDLYLGGLPAIVNTRAFKKW
HIRDGISFKGCFSQVFINRKPQDLTTARNSHKVTPGCQLDPCQGNKCEHGRCKPRKNKPG
YRCKCKRGFSGTFCNIRPTCREIVFRDTYSDPKTKCTSRARIKYRRCEGTCGKTCCKPKK
IKTRKVRLFCPDGSNYVYELPVIRKCGCTKC
Download sequence
Identical sequences V4BVH2
XP_009056234.1.39240 jgi|Lotgi1|232797|estExt_fgenesh2_pg.C_sca_320064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]