SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233055|estExt_fgenesh2_pg.C_sca_340117 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233055|estExt_fgenesh2_pg.C_sca_340117
Domain Number 1 Region: 54-244
Classification Level Classification E-value
Superfamily vWA-like 1.21e-34
Family Integrin A (or I) domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1380-1555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.12e-30
Family Pentraxin (pentaxin) 0.0024
Further Details:      
 
Domain Number 3 Region: 2558-2627
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.03e-18
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 4 Region: 2218-2276
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 2616-2684
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-17
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 6 Region: 3021-3086
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 1862-1931
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 1620-1686
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 2850-2920
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-16
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 10 Region: 1920-1989
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.95e-16
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 11 Region: 1804-1873
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.59e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 12 Region: 3199-3265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000117
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 13 Region: 3139-3208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 14 Region: 1978-2048
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 3375-3440
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2963-3026
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000514
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 3484-3549
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000103
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 18 Region: 2442-2511
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000334
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 19 Region: 3261-3323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 2037-2100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000625
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2732-2801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000653
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 22 Region: 424-494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 23 Region: 2383-2447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 2097-2164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 25 Region: 2790-2855
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 26 Region: 1563-1631
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 27 Region: 2271-2336
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 28 Region: 3444-3495
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000731
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 29 Region: 2501-2569
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000945
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 2904-2962
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000201
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 364-434
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 32 Region: 2674-2743
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000639
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 33 Region: 935-1093
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000801
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 34 Region: 1740-1814
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000834
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 35 Region: 1157-1288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 36 Region: 3076-3142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000032
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 37 Region: 2153-2216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000334
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 38 Region: 2322-2380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000903
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 39 Region: 1678-1750
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 40 Region: 1284-1323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000231
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 41 Region: 1322-1361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000536
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 42 Region: 3557-3620
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000108
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 43 Region: 1130-1169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.019
Further Details:      
 
Domain Number 44 Region: 3318-3377
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000032
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 45 Region: 3611-3675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000167
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 46 Region: 480-539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000431
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 47 Region: 711-774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.005
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|233055|estExt_fgenesh2_pg.C_sca_340117
Domain Number - Region: 261-426
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 3709-3739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000208
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 3670-3706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000437
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 3739-3771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233055|estExt_fgenesh2_pg.C_sca_340117
Sequence length 3777
Sequence
MVCCGKAVYLLRLFILLSVLCCSVGYMRDYYNSLFRPMSLNKAKVETLGNILKRHVQALR
DTENRKVDLVFLVDSSASVGATNFFDELKFVRKLLADFTVDVNATRVSVITFSSRGKVIR
HVDHLTKPKASNQKCGLLADEMPKIRYIGGGTYTLGAFIEAKNVLRAARSDSAKAIFLIT
DGFSNGGDPRPEATELKKLGLKIFTFGIKNGNVRELYDMSSDPKNETCYILDSFEEFEAL
ARRALHEDLHSGSYVTQSKSSCSSLCKEGRECCHLKADCMCGTHTGKYECLCQPGYYGHG
LGKTGCAPCPSKTYKNFTGAGDIKSCSPCPDDNHVSGIGATDISECTCRKGYHNTTDTEC
AAYRCPMLEAPINGYFVNSKCNNVFNAACGLKCRPGYELRGSSLRICQEDSTWSGTTTGC
IMKTCPPLSTPKHGHMICSRDDFTYSTECRFTCDNGFKLVGSRKRSCLAIALWTGINTRC
REITCQPLAPLRDGLITPAGCTAGEVLFGTTCLMTCLSAYTLYGPSTKQCTPGGNWAPPS
NVPNQCVDENPPFIQCPKKLVVDADPDEPETLVSWQLPLAVDNSGLLPRTTAVPALESPA
KLPIGYTTITYIAEDWNKNKAKCKIYIHVVDKTPPRVDKCFSPKAVVSPDKYGNVTWEEP
IFSDNSGEPLQVVKTHTPGWFSMGKTNVTYTAIDKSGNNNTCVLEINVIPHPCEFPEPPV
NGNRTCFENDAGVICKIFCMEGYAFAIPPAPEYFCAYDDMWKPEDQMPFPDCSVKHTSND
LVQEAKFKFTSKLSCRDQKLLNTIKGRFERKVTNRINEICVGDIACGIHGLETTCEEDED
FNKVKFSFGRRKRSVVNPLPRKTFLTFDFSIEGSIKSSGKPDDDKTSQKKLEKTLKKVVR
TLQNDAKDGEFDILTSGKKIFFNGMELDSEDPKFQCPDGQILIGSDCVNCPVGTFFNVVK
RVCESCFRGNYQEKEGSITCFVCPNKTSTSQNNSKSQGECLAQCLPGSFSESGLERCETC
DIGWYQPQYAQTNCTLCPPGLTTPRRGSRTRKDCKEICPRGYVSKNGLEPCFACPRGTFQ
PDIQKSGCFECPNNATTYDIASVALTDCEGNWNIQNDGAISVIQNQQHQLAINKCFENPC
FNGGTCIPKRVAFTCNCPPGFGGLFCKTVVDECQSKPCLNNGSCVTLTGDYRCDCITGFT
GKKCEKDIDDCLSSPCLHKGTCIDGPNSYVCNCPVGYTGVSCENDVNDCTDRPCRNGGTC
TDKPDGFECQCPQGFNGVTCEIEEDECLSHPCRNNGTCVDSPGDYSCICVPGYTGKRCGR
GIDDCKSNPCLNGGKCEDLINAYQCHCTAEFRGAQCQTSLDVNYQLDFAAPGIVDNAQFR
FPDPPLNSLTVTFWMKSDDTLNFGTPYSYAVPGSDNAFTLTDYNGFVVLVNQEKRVTDLE
ANDGLWHHIVVTWSSNRGAWKIYKDGLIIDSGWDLSTGRPVPGGGMFIIGQEQDVVGGEF
STSESFVGSLTHLNVWDDELPLYTIEDMRITCNKYLGNVLAWPDVYKGLRGTLSDSPSTF
CQDCPLPAKPDFGSVAYTDVSAGSSATFSCLRGFNVAGMNDQLCLATGHWEEEPPICAKV
ECGFPGNIQNGYTEGRRYSFDNRVRYHCHKGYQLVGSKTRYCNEYGEWEGDKPQCVEITC
DLPLLSVNTLVKNPQGKYRPRNRVEFTCTPGNVLFTTHDAVICQTDGTWDKSVPTCDMLT
CSSAPDLDNGYPINKKSEYSVGQQVSYECNFGFTFSTTHSNNKGKVTCLPSGSWETDLPV
CEKVTCPAVPMVANANVSGSDILAFSVVEYRCHVGYSMVGDDTIECYENGEWTPGPPECR
PVNCGEPLSFAHGSIQGFSYQLNDVLSYKCDPGYRLNGESRRTCLETGFWSGEERVCNPV
SCDQPNPITNGKIEYDGIDFQSTLNYTCDEGYELVGTRQRSCLETRQWSQAEPDCLPVSC
GPPPDLIYGNFKGMPPYVYGVMVSYYCNDGYEILGNTNLTCESTGWWNNVVPLCIQISCP
PPQPPTNGFVNALGLAYTSKAEYECSDGHILEGVNSRTCQIDKTWTDTVPICKPSECEPP
VEIQNGRVEYKDLSIGAIATYTCELAHRLVGDKIRRCLDSLTWSGQAVMCKPVQCPDSFN
VPNGRVEISGTSFGSLASYICDVGYNLNGDQDRVCDELGVWSGSSSSCLIVDCDKTATVI
SNGKMIGNKFTYGSVIRYECDDGYTMLGSSTRTCESNGEWDQPLPVCQVVQCPSYILANG
YVDGFKRDYGSTVTYSCRQNFRLEGPSSRTCLSGGVWGGADPICVKIVCPQITNIAFGSY
VTIDSRNARYHCDDGFNLVGQQERFCEENGTWSGTEPYCDIIQCPDLSSYTIPHGSLVQN
SIEFGSLVDFLCDDGYQLIGSTGSQCLASGAWSHEFPRCTLISCGEPGAALNAKIIGSDY
TFGAVLNYTCLDGFKMVGDAQRRCGLLGQWEPGSPRCETTICPDLNDIDYGIVTILGNTF
GGSAVYKCVAGYEIFGLDNRMCLASGEWEDQDPICAPIHCHHPHALKNGQITGTDYHFEK
EIVYKCNEGYNLRGNSVRLCQANRRWSGKKPTCDIIRCEDPARFQHGRIEGGVYTLNNTI
TYICHEGYLLVGESTRLCTINSVWNTSAPRCERISCGQFPVIANAVIRGTETLFNTSNVI
ECNKGYTQFGDPTITCLSNASWSVSNFRCNIVQCPPIYTIQQGAVLGSSFDYDIEIYFTC
NIGYDLEGEEALKCLSSGNWDYAIPYCIIVPCPDITVPAHGKVNATSGAYGDDIEYTCKR
GYELIGGNIRRCLDYGDWDILAPYCQIISCPPLPKTITNGRLLSQSDNYTFNSSVEFECN
NGYEMIGNSVLTCRESGMWDSTSPYCIKINCPPPGGLLNGQILGTEDLIEYVCNAGYNLI
GSRERRCTNTGQWDADAPFCAAVSCPPPEKISNGVILGDNFTFGFQIQYLCHLGYNIIGT
EQRTCLALGSWDNQEPACEVVSCGSPRELPNGKIIGRNFTYGQIIQYVCDDGYILNGEQS
RRCTDTGSWTSGKTVCERVTCPLPHIQNGFILNSQTSFYGGTAISIECVLNYRLSGSPYI
ECLNNGTIYPNSLPICNLITCPEITSLENGRVIGSDFTVGRQIEFVCDPSHQLDGEYTLD
CLADGTWNFDIPVCQENFCPTPSQIPNGKYFASHNFKEYRIYDRLTIQCNDGYEVIGETQ
IMCQSDATWSHQFPSCVPVDCGRPQDVLNGQLVGISFKYLDQISYTCNPGYKIKGGGQLE
CGDDGSWVGAYPTCVPICGQPPDIPNASVQVSSRGSRKTARYTCANGYYIIGDPNAICDQ
TGQWTMDNSLSCDLITCPNPTQINHGLYLLNQRVVGSVVTYSCDLGYNLVGLSTMDCRET
GEWHGVIPRCDPVYCGPPQTTTRYSGDDFTFGREVHYECDEGHTLQGYRNLICQANGEWS
GLAPTCQRKSCGPLTIPLHSRVISGDPLRNILYNDTVVYECHAGYVMEGIAELKCLANGR
WNGNQPICQLPLNIVTVCDDRVNVKNSAPFITSYIPGERATVNCKIGYHPRGNMDTTCKQ
DNTWTVPSGRCRRVFCGRPRVRDIVNIVIQGFTYFYNDRIQYMCRPGLRPIKFPPILTCK
ADGRWDGEAACAAECKLPCQNGGMCIGMNRCKCRPGFGGIQCEKPICILPCLNGGVCSSP
YRCSCPKGYRGSRCESAICQTPCENGGKCMRPGKCKCYNGFIPPYCKTKVIDISRRR
Download sequence
Identical sequences V4AGQ6
jgi|Lotgi1|233055|estExt_fgenesh2_pg.C_sca_340117 XP_009056747.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]