SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233060|estExt_fgenesh2_pg.C_sca_340124 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233060|estExt_fgenesh2_pg.C_sca_340124
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.96e-26
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 2 Region: 623-807
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-22
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 3 Region: 815-1040
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-21
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 4 Region: 181-384
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-18
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 5 Region: 1066-1256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000194
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 6 Region: 415-476
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000164
Family Fibrinogen C-terminal domain-like 0.0067
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|233060|estExt_fgenesh2_pg.C_sca_340124
Domain Number - Region: 381-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000286
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233060|estExt_fgenesh2_pg.C_sca_340124
Sequence length 1682
Sequence
MVIGESVTTMTFRGYEWIQYKLYNRKEDKLFSDQNRISLEFKTGRGSGILLYAVGGTPYH
THVTATLRSGKLHTSISFGDTTNDLEFTMGLQLDNNRWHNLTIVHNKRDIFVYLDGDKKY
KEVTADQYFLSLDPNVYIGGGDNFVETRGLQVTRSFVGCLRNVYFNDDSVLHSLKTGKDN
CEYQGGRSAQYGCDAVQEIPITFPIAGSMLQWDVPREKELSVSFRFRTVREVAVLFSIEL
LARDGLGGYEYGYLEVWVKDGKPFLDFVPSTRNKESFRENQSIPSLVNNSQWHTLDLSLH
SSQAKLKVDQVSIRTNVYRKTLEHQGKLVFGYGIGLRRYKRSEGFVGCIEGLVIQGKSID
PISIMESDRAVGLVLDGCNLIDYCSNNNICQHGSICLSDWDGVRCDCSEHYEGKACHFPK
YPRTCDEYFQSGRNMSGIYMVDLDGSGPLLPAHVECQMGKIHDQHEYGETIIEHNFHPNT
TVRQPSFADRQYHLSYRGMSAAQLYALTTVSAKCEQYIKYECYSSPMELGKKTWFKAANG
EIVDYIGSNRAGFCNCLPGEEMCSGERCYCDRGLKKWDQDSGINKNKAQLPLTEVTVLQY
PTGTGNLTIGHLKCWGSVQVPLDKSITFIKSSSYVMLHSWKSGDLRINIKTDQTNALILY
QTPGKGMGNKFCIKIISANEVQFHFVINGKSILKTIYTPISFDTGEWHTIIVEHDKYNLR
LSVDQSRSLYTLRSDIDDLIDFSDGILYIGGLPDGIAGELGETGPGLTGCVRGFVYNNKE
KDLSRLIDGSMTGVTTDCMSSCWPNPCLNGGVCEENWGSYNCICANKWIHYGNDCERDIN
RDAVTMSGTVTSFMVFDSSEYPEALHQTIIFSFRTFKREAMILYIHDEMNNFIQFELQKG
TKLIISYNNFNEVIRETITFDIEHKLSDGKWKQVIAEIIGDSTRLQVEDKTLLIQYPRLK
LRNYNTFPYKESRIPESVFLPRPSEKPVPFVHLYVGGVPKGATTLPTFDGCLRGLKIGKR
IYNLREQGVKAKAGDVTTACETGCIEDRCLNGGYCTEYFKLGQYDCDCTETDYSGQQCQI
EPSGKFDGNSVIEQKFRLPLIDQRSLSEQLSFTFISDGVDPSLYVKGEIIEMAMIYVTSS
KKKDYLLAKLEQDGSVMIETNQEIGIYRMKIPVDFANGKAHELRYKRDGSDMFVTVIPYD
KKGFPIIDGIEEATMNYAAFDLDDIDSIYVGGMAQQTDDFYSVVNFTGCISNVVYTPSKT
SSIRIRPLKDFYTNSSDIKVLGNSVSTCSDKRPNIYGKVSRTPNPPPDEFTDFESVTMPE
WNIGPAKVEIIGGIPIPPTDIIVTTQSLILPKNNTSTLLTDYSVDNMTIVITACIIALCL
ILAIIIALLLVRRRRRLGEYELKKKIVMDGVDGDLDAKVPLNHVTSTPVPHDHLAKLDEF
SMVSATLGPPKMRNNVANDQQANRFSQGSFPMIDDETAFSSAIYNKRKNRPASSISEVLE
ELERRQKNIKDPSTDEICKELEENLKRELELNRAHGEGELEWDPQIDKAPLTYGEITFFN
SPLLLSIPDELEELEMSPSSSIHSLEKKEEDDIVTEGSENPNSNGEYNGDSGYEAESSRP
EGLESIDDSATPDTTIDESPTKLYYDISGIELQDSPNLSVHQKLLPAETRTVLLRKACYL
QV
Download sequence
Identical sequences V4A796
XP_009056753.1.39240 jgi|Lotgi1|233060|estExt_fgenesh2_pg.C_sca_340124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]