SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233119|estExt_fgenesh2_pg.C_sca_350053 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233119|estExt_fgenesh2_pg.C_sca_350053
Domain Number 1 Region: 172-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.026
Further Details:      
 
Domain Number 2 Region: 143-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000199
Family EGF-type module 0.027
Further Details:      
 
Domain Number 3 Region: 79-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000944
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|233119|estExt_fgenesh2_pg.C_sca_350053
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233119|estExt_fgenesh2_pg.C_sca_350053
Sequence length 212
Sequence
MTKMYVYQPTFQCLVIMLFVVFPQFSAFPRKFGNLSNVLMDFCQNSCRNGHCTTDGKSSY
IVKCKCNEGFAGKYCNRSDCNPTCKHGSCVFDGSQQVCKCEKGFSGVDCNNVNLNSILGI
DSIARGRNSVNSSISLPSSLCALNFVCQNGGSCIRFQRGVRCQCVYPYTGTFCQDKCEKV
CQNNGRCLLLDEADVCNCPWGYNGEFCELKLS
Download sequence
Identical sequences V4A6M5
jgi|Lotgi1|233119|estExt_fgenesh2_pg.C_sca_350053 XP_009056910.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]