SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233398|estExt_fgenesh2_pg.C_sca_390072 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233398|estExt_fgenesh2_pg.C_sca_390072
Domain Number 1 Region: 107-147
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000314
Family Tachycitin 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233398|estExt_fgenesh2_pg.C_sca_390072
Sequence length 150
Sequence
MREMGREEKEDERDGGGRRLGREDERDMGGDEIGEGDGEGLKGRGDGFFCFFFTMMYLLS
SAFVLSVLIMATQQQDPNCPYSDGYFEDASDLRFFFHCGGGVGMPNNDCTSFLSCVGWIP
YVMQCPDTTFWNDRDGSCGAYVNSTCFNGY
Download sequence
Identical sequences V4A969
XP_009057681.1.39240 jgi|Lotgi1|233398|estExt_fgenesh2_pg.C_sca_390072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]