SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233802|estExt_fgenesh2_pg.C_sca_440023 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233802|estExt_fgenesh2_pg.C_sca_440023
Domain Number 1 Region: 24-152
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-16
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 2 Region: 148-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233802|estExt_fgenesh2_pg.C_sca_440023
Sequence length 702
Sequence
MRTLTIIFTFLPNFISASIPTYIMDEQCGQTVNMDSESIESGRLLLRRPEASGLRNNNCA
LYIKSPSGKNLVFYFRHLQIETPFGCDRDYVEVYEGLSNKSRSLIGKNCGSLPPSTAFTT
TTPYALIAFQRYLQFFHDQFELIFTAYHKGVCDNDEFTCNNGRCIHNSLYCNEYNNCGDG
SDICALTTAELVGVVVACLFVILLIAVIVAAVFFIRRRRLRRQQFARTMDFYSSYNSQKS
HGLDWFPLYGHPSVTRHDSHRIRLLDPATLQTEHPSAVSANACRDPAVWVRDHPQRNPSS
RFSSREAFNIDRPQRSASFAKGDYPFGLTDDRPQSFYNIDHSAPQRSQSMYVTDGSSASI
DKRPYVLPTYSYHPKRSQSMNVRHGPSASLDKRPYVSSRFENQEEYPMTYMGRTPYVESS
HVDKEPRIEVPLRDYWEFEDRNAYTPSTGYPYTTNLELPYPYTGSTRFIAPQEPRHETNH
KVNQDDYPYVARLPVRNESRTSGHASHRGETLDDCLISFRSYPSPVPAADIALYRPKLKD
ALGYDEVDSRLKSRSQPDLSKIYTTSLPRSFPVRRNESHHGKTKQTKGHKNKAFTSNAHF
TDVANTDPVIQKRHIDKPQLPVNANRANQYSPVITVAGKGTIDGSYGRAKHQHPGAPESV
PNRHLGVARQAEDRSQGSSDGLYNYDQQQDEIFYPPTSTFRL
Download sequence
Identical sequences V4BMR1
XP_009058936.1.39240 jgi|Lotgi1|233802|estExt_fgenesh2_pg.C_sca_440023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]