SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233803|estExt_fgenesh2_pg.C_sca_440025 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233803|estExt_fgenesh2_pg.C_sca_440025
Domain Number 1 Region: 602-702
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-18
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 181-309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000638
Family Fucose binding lectin 0.052
Further Details:      
 
Domain Number 3 Region: 704-738
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233803|estExt_fgenesh2_pg.C_sca_440025
Sequence length 855
Sequence
MARRILTALLNGTSYIPSLTALLNGTSYIPSLTALLNGTSYIPSLTALLNGTSYIPSLTA
LLKGTSYIPSLTALLNGTSYIPSLTALLNGTSYIPSLTVLLNGTSYIPSLTALLNGTSYI
PSLTALLNGTSYIPSLTALLNRTSYIPSLTALLNGTSYIPSLTALLNGTSYIPSLTALLN
ENVALNKSPSQVETNRTKREAGDRTTNIPDKCYNYNKTGKWLGIDLEEDYPIKHIIIQHL
ASVNGILLHVIKENGEPELCYKEGLSSTPPIVKNIECSHVIYGRYVNITNDRISHNGRYL
TLCEVEIYVCSGGTFGSDCTNFCHCLNNKRCSETGECPNGCSDGWTGTTCSQMCDNGTYG
AGCLKQCSDRNCLVETSPCHHIYGSCQGGCTEGFYGEVCDMKCSDRKCNDSNLQCESKTG
ECIDGCQPGYQSIDCTRECYNGKYGQDCLLNCSSRFCKLETECNNIDGACNCSDGYQGID
CTVKQQLVFPGDANEGSEDQNSAIIAKIVVPVITLAFVFGVLVVLFGTKLRSRCKTNQFR
GKESSHAVAQNETNIKLTFSAMVSPSASFTWKLLDYMDDLCGKTLKLSAIGRESAVLKLT
KHGEYTGTMNCITTIMATDNKQIMLKYIQMDIKSYHECPGDYLAVYDGHYQPGSRISKEP
MSVFCGDDTPRLTYSSTGQFLTLRFVSDDSAHGEGFEVVLTAFHNGTCGSSEYRCDNGRC
ISHALVCNGYNNCGDYSDWCVLSPAVISGIVIACFVAVITIWVCMVFVWYAYTYRQQRLH
RRTRRRHRPQLSSMVGEPSRYSHLLPPERSSSRRDDVFTVFPQLRISITPIQPPPYPGEP
SPSEGAHNLGYRHGP
Download sequence
Identical sequences V4AAC6
jgi|Lotgi1|233803|estExt_fgenesh2_pg.C_sca_440025 XP_009058938.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]