SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233824|estExt_fgenesh2_pg.C_sca_440067 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233824|estExt_fgenesh2_pg.C_sca_440067
Domain Number 1 Region: 261-367
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 29-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-19
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 455-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 155-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 5 Region: 410-447
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000733
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|233824|estExt_fgenesh2_pg.C_sca_440067
Domain Number - Region: 206-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000144
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number - Region: 370-408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00314
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233824|estExt_fgenesh2_pg.C_sca_440067
Sequence length 819
Sequence
MDLGGVSRFQFLTVCFLVCQYFHVSDSFGCGRETISAEEGGVIKSPNYPLNYPSDYCKTW
FIQAPEGKRIILQTEAGSDVNKQHAVPGFCDHDMLKFGPTPSKTYCNLFNSIPPYISSSS
HVWIRLYTDSHLTAPGFKLIYKVVDEKDIEARSSYCYYQCGNGECYRLEEKCNGYRDCPD
NSDEENCYQSESTQTTTPEVRERKPLQCGIHEIKCRLKLTNHLGCLSSLHHCDEKEDCVS
GEDEHPLLCQINDNSCHEYIHQDKGTILSPRYPGNYPNSISCEYQIHSTVPNRAIQLRFN
DFHLQAVKNTDYLVVYDGQDRTSALLGVYNGIIHPPYMLESNTEWVLVRFRTDSTITSTG
FNITYQTAGLCIAGQTSCGGSDRNCFDSKQKCNRVWDCKHHGTDELGCDHCSKSEFSCGP
GDYKCYREDVRCDGKGFCADYSDEKNCTSDKCSSHNGLYLCLNGRCIYEKWICDNSDDCG
DGSDEADCSGSPTRVIIAAVVGSLICSLLLVVALGCTCRLYIFRTRDSCRQRHSTPLSRL
QVEIMGRRPPPPSYNEAMLTSRPYEEVRQEIISRSTTNGEINMANRPLPVPPYEASSTVA
IATDNCTAELIPESNSDSETSGCDNMNCPSSDDELLDLTEDSDVHIRMTQDVGLLAAWHS
NSSLHVDDSGDTLLLDLSEKSSPSCDSDSKSTAQTDCLVDISTNDVSDSTATELEPSDSQ
IPETAPRDSPVTESEPSDTLTPESEHSDAPSFSNSDLNTTTSRHILNISDPHCDNNSNTP
DARTQDESSQDSSYVTPESTSSTDMPFADSSDTVPLLES
Download sequence
Identical sequences V4BMV6
jgi|Lotgi1|233824|estExt_fgenesh2_pg.C_sca_440067 XP_009058981.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]