SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234334|estExt_fgenesh2_pg.C_sca_490125 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234334|estExt_fgenesh2_pg.C_sca_490125
Domain Number 1 Region: 126-183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000053
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 2 Region: 76-140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000848
Family Complement control module/SCR domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234334|estExt_fgenesh2_pg.C_sca_490125
Sequence length 246
Sequence
MHAGRLLYPVVLFCITSWTVVAQGGTNEFTTPGRPTTTRRTTPDGSDEFTTPGRPTTTRR
TTPGRPTTTRRTTPGCMTEPNISNAIITTNSPTLFTTVNITCREGFRMTQILSCDSDNLK
YEDTECRPVECPLNPVIRNGDLTFAIGSRVIGVKYNFRCKRPFTKQGRGGTVICNTCGEW
ETDITCVGPCQFQEVGCQGFPPGYAPIVKTRENYGLHARHHVTTILGVRHGLSSSIAANY
THLLSL
Download sequence
Identical sequences V4A3J9
jgi|Lotgi1|234334|estExt_fgenesh2_pg.C_sca_490125 XP_009059883.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]