SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234340|estExt_fgenesh2_pg.C_sca_490132 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234340|estExt_fgenesh2_pg.C_sca_490132
Domain Number 1 Region: 12-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.68e-23
Family C-type lectin domain 0.0027
Further Details:      
 
Domain Number 2 Region: 2256-2417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.59e-21
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 3 Region: 199-316
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-19
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 4 Region: 433-545
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-19
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 5 Region: 329-431
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-16
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 6 Region: 612-680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000764
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 7 Region: 890-959
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000297
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 670-732
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 1849-1886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000468
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 10 Region: 1928-1969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000917
Family EGF-type module 0.007
Further Details:      
 
Domain Number 11 Region: 158-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 2047-2087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 13 Region: 1695-1729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000024
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 1531-1657
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000432
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 15 Region: 2158-2201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000726
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 16 Region: 1811-1853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 1080-1151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000107
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 18 Region: 821-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.038
Further Details:      
 
Domain Number 19 Region: 2197-2238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000191
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 1732-1770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000305
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 2085-2127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000044
Family EGF-type module 0.014
Further Details:      
 
Domain Number 22 Region: 1321-1377
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000653
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 23 Region: 1769-1810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000099
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 24 Region: 778-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.013
Further Details:      
 
Domain Number 25 Region: 2000-2047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000244
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 26 Region: 1965-2010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000031
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|234340|estExt_fgenesh2_pg.C_sca_490132
Domain Number - Region: 726-781
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000264
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number - Region: 554-622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000334
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Domain Number - Region: 2733-2855
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00369
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number - Region: 1016-1084
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00375
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number - Region: 2130-2162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0133
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234340|estExt_fgenesh2_pg.C_sca_490132
Sequence length 3099
Sequence
MTGPYLLSSLRLFFNVKMTDTPVKICQDLTLKCPQGWTEILSTCYLPVTDLHTTWRHAYT
YCQRFGGKLAEPAGEDQTKQVSRLITNTTTSHWIGFTQNGIPDNAPEQGFWSDDKPTTVD
AGWWDNFQPDRRGGDCTVLRYTTEWKWYMTQCLELRPFICETTSCPTDTFRCLEGECLNT
DIVCDGKADCLEGWDEINCASDCNQYLQSSEGQITHPPNQLSTYSPRTTCQWTIHGTEGH
NLVLDISELDLEDGIDYLEIWTSGLTISTSRLHSRLTGTNLQNLQSIYSSNNCAIIRLVT
DPSNQFAGFTLDWESVSDLVSGDTVLQATGVYQQLSSPLYPNIYLDNLYTAWLIKATGSN
IITIEITDLDISSNGKVTIFDGDSPGSPVLKVLTHGIQDSVILSTSSAVHILYESGTSDP
VFRKGFQLKYKEGCNFVLAAAQGEISSPGYSRGKYPNILDCTWLISSQSGTPLTLQFNSI
FSIEQDKDFLKVFRSSSENDPAHSGEGFTGVTVPALIVSGSGSLLIKFTTSALGQAKGFM
ATFSAGCKGLQSPYVHAFPHHATYHLNEVLNVTCTKNHIFSNVAYLGLTSVLLTCTAGGN
FDKEIPICSKTLCGPAPEIRNGYIRSSNGVYSGSTVTYSCNFGYNLTSSSTITCQNSGQW
PIPSTCHAESCPPVPDISNGNKAVIYGDGVSQGSVVKYTCQSTFQIVGVNTRTCQNGKWS
AVAPTCQRIPCGYTKIENGVISVLTQPYQGEQVTLRCNTGYHISSGSDTFPCGEIPPLCV
NINECTSRTDNCVKSQCKDTDGSFECVCNPGYYKPYNGANTCQDINECNVNNGGCGQICN
NVDGSYTCSCYDNNVLFTTNGQNGYFVRSGETGTDSWNSMRFQHTCIPVECPVPPRNIGN
GRSTVSKLHYQIGDQVSFVCNIGYVPQGTTTITCQSNGSWDFTPPLCLDATCPYPEVPNS
PNAVSVTPTNSIRYLDVFTLTCPLPTQSSQVRPCIYDQANRDYRIMSGSLECPETDCGRP
ERIPGSDPYSNSCTTYGCSFNFRCRTPWFQVAGSSSKGNTVTCGSDGHWDFGDLRCPGPT
CTDPGTPAGGKQIYTTYEEYSLVYYKCNENNQKPGFEPSAQYPLKCIWNSNRNELMWNDT
TPTCVDRTAPVFFNCPTMDIKVSRMSTSTVAEPQITDNSGAIQSLRIYPDKFSVNHVIKS
DESVRYEATDHSGNTGFCAFNIKLKDEQKPVIKCRDSFGINFFNENDFRSFDVNSLIISA
SDDSGNVDVTGSVDIIRLDRNSIGKTYTNTITATDPSGNTASCIIQVTATADKCRPWTLQ
IQNGGKNCNSKSGGGYICTVTCNNGYVFYDNTAQSSVDISCDPNGDWSREVPVCVAVESS
IYELAIRVTYVTDSNIKDYCPDNYQKELTGKMPSLVSSLSSRCQSLSPSIRVEAGRSTTI
QNFNSGVYAIFYFNLEPRDYDSSTYSNCVNLIRQAFIDQSQTVSAVRQLSVNPNIGCPGS
QAGTYQTIVNDGFTCNVNEEVRQISQDYTGCVTCPLGYYSTDGRLCIKCLPGFYRDQNLQ
SCVPCLSNSRNQTEGASSIHECYSLCPMGMNSNSGRSPCSQCRENSYSQDERTCRQCPPN
TFTPGRGAASVDDCRGICQPGYYSTTGFEPCQVCPRGFFQSNTRSTTCFECSLDQTTFNT
ASTSSSQCTLTVDIDCQNGVCQNGGTCLVEKHQYYCRCTSGYTGKNCETPIRACDSSPCF
NDGVCSNNDDGSFTCFCNQGRFSGGRCENDINDCSINSCLNNGSCYDDIGSFSCVCPIFS
GFTGGSCQRSRDVCSEQPCQNSGQCIASGNIRRKCVCQLGYTGDNCEAQINECSSSPCRN
RGTCIDQQNRYECRCMQGYTGSNCEILSDPCSTFVCNNGDCLYNYQTATTDCVCFYGYEK
VNGQCQAINPCQSSPCKNGGTCRPGNSTYTCDCLAGYEGTQCQQNRDDCASSPCKNGATC
VDQLNDYRCECDINKPDTRGKNCEDQVNSCSSNPCKGNNTKSCTDHLGYYECDCYNGYSG
LNCQDLVNHCASYPCLHGGSCTNIFGGYKCLCTATYTGSRCERATDFCTQESCRNGGQCI
STDTGYVCSCKNGFKGQFCENTYDLCSKANPCVGTGSICSYDGTRFTCQCSGGYTGDYCE
FRNNVCSDSRCLHGGTCLEVGGQPQCQCASGYTGSLCETNINDCTTTSCGQGAQCIDGVN
TFTCECESGKIGRNCDKDLTYDFDMTLSKSGQFLASDYFILPQRLQSTTMFSLSFWVRYS
KSTDPGLILTMYGTRSQDKLAESFEILRIVRDKVTAYIGNTQSISYSEADIDDGKWHHVV
VTWDGTFPLLTLYIDNTEVEALNYVLNPPLPTYIWFVLGGTYDVTTNKIDQSKSMIGRMS
RLFVTPSVLSAADRLSLSYALSFVPANHIQGFTVGMLDGVNALVDHNSELNPSGCYRNKT
CPPLLSAGSKASVSVCPSDMMTVSARVSRPTWPQPIFTNTDVIRTNYISGGEPMSWKTYS
IAFGGYDTQGNADVCSYNLYNRRAACPVPKKPLLGTINCVSIQAGVRCTVTCGENQRLAE
PTPVYYSCGFFNAYNENILTYRYPSCTSCEAPKLDVEISMTFDLQASCTSIGESVIASGV
RSSLNDLNTRLNQQLCGGNDCSSISISARCSIVGQDVNIVVRMFSLRSTMTVNRLPVSTA
NVLASSIIDDTAITVNLGTLDRMSYDLQSTRICEVGRQLVSDCCAECGFGTYYDTSRSTC
VQCQRGTYLDTKGVIFTSTAEVASPCKACPGGMTTALTGSQTVDECKDSCSPGRFYNLTI
GRCEDCPAGYFQETAGTFFCQPCSITSTTANNGSMSSSDCVLASSIAPETTTPLSEGTDS
PSVGASTGSDIWSGEVIALAVIAVLVIIVLILVILCVCCRGCLQSICPCCVTKVSPVEKT
QWQYVNRFGETNLKFVSYKLSDIRRKKLEKEALMKAEEPRKISIQVPVFEEKLDGKVKKK
SLHVSRPTSGRPPQSTSIPIFSVNSPGHYQNQPKPLPPLPDRIKNTPPNSPITIRRPPSA
FNKPRVQPTEDDYKDFILRNNTQATDSRITIDSDEEDYR
Download sequence
Identical sequences V3ZEG9
XP_009059891.1.39240 jgi|Lotgi1|234340|estExt_fgenesh2_pg.C_sca_490132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]