SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234475|estExt_fgenesh2_pg.C_sca_510081 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|234475|estExt_fgenesh2_pg.C_sca_510081
Domain Number - Region: 50-144,578-601
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00455
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234475|estExt_fgenesh2_pg.C_sca_510081
Sequence length 759
Sequence
MSAICRGRSDSRACNENFPNSHIVLPDKTTVKNSVGKCIRPNVYECKQEGFYSAGSFCNI
CSPIKNCDLEYRTTKSDQRCRRCEGLVADISWYRAYIISTDKRFCKKSCSWRPDSRCYPG
TCRDELFSNCYCSVGFSGTHCNRITAIPDILYNQVTLTAYNGETVDAPDGRNGVKTQTVS
CTTIRKDNPNQGLLDCTKTIKRTFPVPFQHLEQLSFKITTTIGGFVKIKNLERNVYNTYY
YTPNSMSRAFEIKFDNVPPYHCQPVDNCKLTMLTDIDITKKVENTVYWDGWIGEDSGIAK
YELEIFSMKSVGNELIIDKRIFDTETTLKSQQFNLTIPGVYSVILAAVDKAGNIRLARRC
LIFDDNSEVSTVHNTNLKTRSASPSTNYLWQQNHGPVTIDWENRYINTKHHNGKYLAGIQ
DYHGLDPEYDDHYGIRTTKHIDNVQDDQGGSTIQPTDTDFTTTGNLNQSITISPTLQDGD
TVKFYIRAYDIVDFYLEESTTVYFDMSPPVIKDLWLTKGDKVDLAVHGFQDFDKLVIEWI
AYDLHSGLETVEWKLYDNFTGDVILQGSQHIPEQGEAQTRKECKEKYQNSSRGSCHCYCT
PAFGCYLQHFQVKPGVSLDKGTGLIDGKHQGVHDYDYYIEITIDTSPPHVGVVHDGRYDE
PEVDYQPDRILQAHWEGFSDKESGVRYYHYGFSTGCLTAEDFHFEIQNTPDIHESSVTHA
TWVAPTDGQYYITVVAYNAAIQPSQPVCSDGVVIDSTQP
Download sequence
Identical sequences V4BIX7
XP_009060667.1.39240 jgi|Lotgi1|234475|estExt_fgenesh2_pg.C_sca_510081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]