SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234725|estExt_fgenesh2_pg.C_sca_540097 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234725|estExt_fgenesh2_pg.C_sca_540097
Domain Number 1 Region: 69-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000355
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|234725|estExt_fgenesh2_pg.C_sca_540097
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.062
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234725|estExt_fgenesh2_pg.C_sca_540097
Sequence length 234
Sequence
MLSIRVLGLFAVIAIALVLVESEFSEVCYGELPANAMCSVENNKTRRCQCKEGYEMDIIC
TSNGSIFSCQDIDECATNNGSCEFKCQNEPGSYNCSCPEGSELQENGLNCEPIKPGPCMF
ENQTVTGVSQNFNRTYIGNENETECEKKCNTTVGCTDWLILDGHCQNFGLPIIQVELIPD
GSPEKCKDLCAQNKKCVTAQYFVTCTLFDTKQTEFDDGCDPETVFHKIDMNCLN
Download sequence
Identical sequences V3ZUY1
jgi|Lotgi1|234725|estExt_fgenesh2_pg.C_sca_540097 XP_009061202.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]