SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234764|estExt_fgenesh2_pg.C_sca_550024 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234764|estExt_fgenesh2_pg.C_sca_550024
Domain Number 1 Region: 2236-2432
Classification Level Classification E-value
Superfamily vWA-like 7.99e-52
Family Integrin A (or I) domain 0.00065
Further Details:      
 
Domain Number 2 Region: 663-864
Classification Level Classification E-value
Superfamily vWA-like 7.86e-49
Family Integrin A (or I) domain 0.00049
Further Details:      
 
Domain Number 3 Region: 233-445
Classification Level Classification E-value
Superfamily vWA-like 1.7e-48
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 4 Region: 24-228
Classification Level Classification E-value
Superfamily vWA-like 4.45e-48
Family Integrin A (or I) domain 0.00039
Further Details:      
 
Domain Number 5 Region: 465-660
Classification Level Classification E-value
Superfamily vWA-like 3.93e-47
Family Integrin A (or I) domain 0.00041
Further Details:      
 
Domain Number 6 Region: 1529-1729
Classification Level Classification E-value
Superfamily vWA-like 8.51e-45
Family Integrin A (or I) domain 0.00082
Further Details:      
 
Domain Number 7 Region: 2435-2654
Classification Level Classification E-value
Superfamily vWA-like 8.74e-43
Family Integrin A (or I) domain 0.00057
Further Details:      
 
Domain Number 8 Region: 875-1064
Classification Level Classification E-value
Superfamily vWA-like 1.44e-42
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 9 Region: 1734-1930
Classification Level Classification E-value
Superfamily vWA-like 2.23e-34
Family Integrin A (or I) domain 0.0022
Further Details:      
 
Domain Number 10 Region: 1989-2202
Classification Level Classification E-value
Superfamily vWA-like 8.34e-33
Family Integrin A (or I) domain 0.0021
Further Details:      
 
Domain Number 11 Region: 1316-1490
Classification Level Classification E-value
Superfamily vWA-like 3.62e-25
Family Integrin A (or I) domain 0.0026
Further Details:      
 
Domain Number 12 Region: 1076-1248
Classification Level Classification E-value
Superfamily vWA-like 6.02e-24
Family Integrin A (or I) domain 0.0021
Further Details:      
 
Domain Number 13 Region: 2208-2247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000472
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234764|estExt_fgenesh2_pg.C_sca_550024
Sequence length 2702
Sequence
MYRRWRNLLSKLVTVLRSSQIVLSAPEPTPIPITLAPAGKSCTETPIDLVIILDASTSVT
EPNFKLMLNFLKDFLSGADIDGGRVRVGVIIYSTKDHVQFHLNRYKTNQDVYNAIDNIPY
RFGSTNTANALRTVHREMFTQRNGDRPGVDNICILLTDGVSNINSRRTIPEAEAARSKNI
HIYVIGIGLTDLREVDGIATRPIEENRFAVKDFNELTPMKDKVFKSLCFSQSPQPVRTTT
APEPTPIPITLAPAVKSCSGTPIDLVIILDASTSVTEPNFKLMLNFLKDFLSGADIDGGS
ARVGVIIYSTNDHVQFHLNRYKTNQDVYNAIDNIPYRFGSTNTANALRTVHREMFTQRNG
DRPGVDNICILLTDGVSNINSRRTIPEAEAARSKNIHIYVIGIGLTDLREVDGIATRPIE
ENRFAVKDFNELTPMKDKVFKSLCSSQSPQPVRTTTAETPLPITLAPARGRDCASAKTDL
VFILDASTSVTEPNFKKMLNFLKDFLTVADLDSGNVRVGVVIYSTKDHVIFHLNEYSNRR
DIYNAIDNIPYRFGSTNTADALKTMHTEMFTQRNGDRPGVENVCILVTDGVSNINSRKTI
SEGENARNKNIHMYVIGIGLKDTREIDGIATKPLEQNRFNVADFDLLVGLKDQVFASYCG
SSKPPSFVTLPPPTETCGRSKVDLIFVLDSSTSVTQANFDKMLRFVQEILRYADIDTDYI
RAGLVTFSNEVYVQFHLNEYTRKSDMLRRIQNTKFNYGKTNTAGALRTMRTEMFTPFKGD
RPLVPNIAIVITDGVSTENPRNTIPEARRAHQEGILIYSIGIGLTDTRELNSIATPPARD
NAFSVNTFDELITLRDLVFSAICPKTAAPTPPPSCGFSKLDLALMLDTSSSVTQENFNKI
KHSVKNLIKMLDIDSGNVQVSLITYSTDTFIQFHMKTFKRKDEMLKKIDEVPYQFGLTNT
AGVFDFMRKYIFSRRAGDRTDVPDMVVLMTDGVSDVNSANTIPQARGALAEGKHIIGVGI
GLPDAKEIRQLVSQPVTENLIILRNFNELWRLEEKLIRKMCSAATPRPTAYSPTGYDVVL
MLDTSVTDRQMGWIKNFAKNIVSEMDVDTGEYRVGAMTFGRRPNVEYDLEKHKFSDEAVV
PFDKLSTTRGTPDMVSAFDTVRNRMFTQPSGDRPRARNFIVMITGNEGSRNTPQAVAAAK
RLENAGVGIYTVGLNLRNTNEIDGISTKPLSEWQYLVNSEPGLMETPSVILYNMRNAGPV
PPPTTPPPTTTTRRTTTTRRPTTTRRTTTRRTTTRRTTTRRTTTTPRPTAYSPTGYDVVL
MLDSTVNNEQWGWMKDYAKNFINQMDMASGEYRVSTMTFGAAPRVEYYLDKHHHTDEAAA
PVDKFRQTRGTPDFSRAFNAVRDRIFTNNRGDRPRAKNFVVIVTGNEKGRHSGRSAEAAK
RLEHTGAGIFTVGLNLGDTTELDGMTTDPREEYQFLVNNKPGLEETSGVILYNMQNAAEI
TAPPPTTRRPVTRRPVTRRPTLEPVTYDWTNTECKTTADILFLIDTSGSVGQDNFGKLIN
FTIAAVAQLDIDLGLHRVGMMTFSDSAHIAFQLNQYQRKSELISAIRRVNYHYGYTHTAE
AFRVARERMLTPGAGDRADSPNMIVIVTDGESNINPAETVPEARYLKRLGNSIITVGIGF
TQEYINADTHSSNELRDITSPPMEDNLMFVDNYDSLVHLKDKLVHPICTDPDLCQTAPCQ
NGGICLDGLRSYTCVCQPDYFGHDCDKSCGQPADVAFILDSSTTVGSSNFARIKMYAEQL
VREMNVENCNIRIGVLKYSSAPMLQFSIGELGTDTEAITRAINRISYTRGRANMAGALHS
LRTSVFNGYNGDRSGVRNVAYLITDGSAEINRDNTMAEAELAIQSGIRLIPIGVELRDRE
EVTNIAESQGITLTEMNDGESIRDKSDILMNNLHDKSYSVSGGGNGSAGGSGTGFGAGSD
YCSGSPCLNGGTCYNDGNSYRCECSGGYSGTDCEQECSGKADVVFVVESSRYSTRKDFRM
IKRFIRNVVLKMIFRTDSYRVAIVEYGSSSKVVLNLADGDKKRNVQTHVAGLRLIGGEPD
PANALKKVLYSVINSPGDRRDVPNYVVFLTRSMNNFYEISKTANKLKVSGARIISVGIDT
TATMNEQLQTISSYPTDRTLFLARDASDLQDTASEFTNFVCESTGKSVDVCRDNPCLNNG
RCEPSGTGYMCSCSSGYAGKDCERSCNSKADIVFLIDSSGSVGGQSFRVIKDYIHHLVEN
MNIGSDATRVGAAIFNSFSKTEFYLDQYSNKRDLQNAISGIQYEYGNTNTAGGIKMARTQ
IFNKKRGDRENVPNFLFILTDGLSNVKAENTIPEATAAKDQGIHIFAVGVGFADRWEVDA
MASEPISNNAFMVENFQSLWNISGDIINYVCRDDSVCADNPCLNDGLCIPGIGDYKCNCQ
DGYLGKNCDIDCRARKDIAIVVDSSTSVGPENFQVMLKYLADLIESLTAGGQDHRFALIL
YSTRVNLIFSFKRYRRLDQILDAVYTTQYMPGATNTAGGLRVAGEVFGDGYGERFGADNV
ALLLTDGKSNLNYEDTLPAAEDLKKAGVKVITLGIGLKDTQEITDIASSPQDVFQVTSFD
TLDEIKQDIVGNSCVEVQQTPRGRRPEPRVEEPERNEEDFGREEGGYGGEEGGYGGGDDY
GR
Download sequence
Identical sequences V3ZAH6
XP_009061283.1.39240 jgi|Lotgi1|234764|estExt_fgenesh2_pg.C_sca_550024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]