SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234824|estExt_fgenesh2_pg.C_sca_560001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234824|estExt_fgenesh2_pg.C_sca_560001
Domain Number 1 Region: 6237-6423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000563
Family Clostridium neurotoxins, the second last domain 0.042
Further Details:      
 
Domain Number 2 Region: 3179-3337
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000127
Family Glycosyl hydrolases family 16 0.069
Further Details:      
 
Domain Number 3 Region: 5221-5396
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000102
Family Glycosyl hydrolases family 16 0.093
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|234824|estExt_fgenesh2_pg.C_sca_560001
Domain Number - Region: 4237-4345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00019
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.048
Further Details:      
 
Domain Number - Region: 3991-4015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 1126-1150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 6043-6067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 193-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0259
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 2974-2998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0414
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 4021-4105
Classification Level Classification E-value
Superfamily E set domains 0.08
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.051
Further Details:      
 
Domain Number - Region: 5046-5071
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0879
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234824|estExt_fgenesh2_pg.C_sca_560001
Sequence length 7546
Sequence
MDKCYCLYRVKEAESHYSGICEELESNNKQLVYCKCLPSGPECSPYNDIVSCYQDDDIEL
SITDGTDVTKLFLQEAISPLGCTVDTKKVIFEYEVSTFPTPLGKTEDDAREYCFNYIVST
SIGGSCYEIGLLDAEIERTLQSCIIDIKITDDLTWAENALTNFVEQCLSLYSRDVTLWSR
GRVDFIVTEICPNLCSGNGYCSQGACKCNEGYIGADCSVNKTVAPSIKFTTGNQCDLKVN
ECKSIGILGGPFIISDNLTCIVTKLQYDGEYNYVSTGVTVTTQTIFFTYEYIQCKLPSKG
SYEISVTNNGLLVSTVQTYKVYDTRCFECSADGCKLKDKYCYIDDTCYKIGDTSDENDNL
LCDPQRNITSWTNRQSFTDIGVIPTLKTSYNKTEPMFNFVCDWSSYVDNDTTLTIFTQWF
VDDVQITEVEIERNVTMDTLPRSSIDSLDYGTKVFCGLVACITTDCNNTRSPLVKSEDFI
VEIQVITKSTLKIKEGEDGKVFRVKSTFPPSILCPETKPDCSIQLKYHIPSDAKDIYCPS
SKQIMPQAVIEQVKGDNSTVPACGIFLTEENWMTQFTISVRATVDLKKDKNQKRKVMIST
EIPSRNSTVTFVTYQIGQINLEIEDNDKGSTCSSVNDPHITTFDGRYYNNFFLGEFILYR
HVKFSYAVHAFYRPCSSNNKRKGASCNCAVAVKVDDDVVIIDKCGPKKDYNRKHPVTVTL
YKNGEVTPGFQVIQYNKGRKYTIMLPSGMIVSVKVNGRNINLFVQASSVDFKQTEGLCGT
YDNDKDNDYLTPDGKYLSLKGKFPDDFSKLWRVNKKDSIYGGVCASTELSRQTATTYCTC
GQGGDISCAGNGFVRGCFDSLKKRKRGTDVTDYLISQSYTRTTNCDTQPDTIFVFDYMIH
DVINLYCTDVTDYLISQSYTRTTNCDTQPNTIFVFDCMIHDIIYLYCTDVTDYLISQSYT
RTTNCDTQPNTIFVFDYMIHDIINLYCTDVTDYLISQSYTRTTNCDTQPDTIFEYDETYI
HKIPTWPSGEYTLETATEFCQKYVLQSQVGNVCTSKIPALNTFSSVQACIEDIQVFGDTS
FAQTALESLKLQCTIVIEINIEFWITINGVITIDPEIDDIICPFDCNGQGTCKKGECECN
RGFVGDDCSIDLNIPPSVFIPLSPIYCNTANKPCTTQVLIYGENFYDSNDLVCQIRQIQI
SSTELTISKSSVSVKATFINLNTIQCELPSLISYAVKISNDGVTFSDDVNILMINTDCVK
CDSLDSCRIMPDMCYINGKCYNIDGVSEKDVNMFCIPSKTQMAFSPKPDYPSVKKPTLKI
VDLEESPYQQLLCEFDRVDSRDLQYLVYWYTSSETIVDNGPFTSVKNISTTTAESFTSFN
YGEMVHCGVTVCYTLDCDNTRSPVVNSTIITATVQVKETNITIIEGQKAQMVHVHSPFSP
GFFCGNMSAWKSCRYVLTTKIEIAEELICGNMVVNQAVFGESIDKVPCSLGITWQNYKEP
LAIPVKATVDSLRDGDQTRKLKISVKLHKDEEVLEEVTLESVELTIKDNDKKALCNIANY
PYITTFDGTSYKHFMEGEFIVYKHKTMPFEVHGLFSQCKENLPCSCGVVIKSHDDVIVLD
KCKMADAGHRPLSVQVYKNGDFAEGTKIVRYSSGHKYKVFLPTGTTVTVIAEKQHISYWI
QASTYDYQQTMGLCGSYDNENSNDLMLADNTQTTDTSGTPRKFSRSWRTDMSLYYGYCPN
GEDKKMMMEMPVYCKCNENQNEICQAQLDVTRCTGSDDKSLTGILRGDDVTDQYVKLSMK
PKQCSCNLREPPLMFKYDVDYVYIDAGWPTDAPITEADVRKPSFKETLFNTTVYKQCMKV
TGIQLNYKTAFESCIERIKMFGYEKSLPWCSHVQFNVIYECLYEVTTNVELWVNSKPPAI
ILNIVCPNNCNMKGTCVEGVCVCEKEYGGVDCSIDTSQPPTVTDVLSGSLCDAATNKDCQ
SVYITGSGFIDNGTLTCHIQAIQVNGQYDKELNQTEMPAKFISGEMVKCELPAMSNVNIS
ISNNGVLMSENAVDYIIYNPTCEMCNTTVCTPRDDICTIREKCYECGQIFRDDPTKVCRP
SLNNTEWTAIKEEDIDIQRYQVDNIDADTLSTLSGNFDIKGKPTLVEGFGGGKAIRVNIA
DDKLTMKDNHPVLSDLQNCSLGFRLKFYLKFESFCEDTLILHTDGGAANGMGMSVSYRWG
QLYFTVTTEDKEWTIASSFKLIDKFVEFELNWEKGWGMELKAMDTVWMMREHCKRKTSGL
TKGPLTIGGLMSAPEKCNGHFVFGGLEISNVPILVLDAMDIITDVPVLLQKPTLSISFDD
IMDGGDIETLEAKFKCEFERLERSDVEYTVKWYIDDEEVKNVSLTKESEDYMMESSYKKW
TYGIKTYCMVTPCYKFDCKKYEGPAQASNVITAEILVKEEKLELSEGQSVMVHVHSTVPP
HMLCPVGRPDVAKGTATVNSQLGEFDGKQQICPGDNPLIQAVLGYTQNDSPCRYQITDSN
WNKPLEIPVRATVDGVLDGAVNGMLKISTVINCDGMTDKIEKDFKPIQIKIEDNDSELLC
ESINGPHINTFSGITFNNFFEGEFVLYKHTKMPYEVHGLYKKCNAFASCNCGVTVKVDDD
VLVVDNCTPEKGLPALVTLYKNEELTPGFLVLRYEDGAKLEIVLPSGTTVTVRVESNPVL
PNYLNVWIKPSPLDIQQTEDICGSSIKATVAPFWGVDLSRESNGLCGVYSPVKKENEETL
KLPDGKYFTQRNINLFTVAWRVTKEMRLYNGYCPEETVETEIVKYCSCQNTDKPCETDTF
NINCRPPKTVNEVITYADITEELVKLSIEPVKCVTPGEEKEIDYDDNFMAKVPEWPTPGG
LEYEDVRKICQQAININQASQGCISLPGFNIKKLLEWCIADIQPTDNKIWADILVVNVKE
ECRHRITIKISIWITITGTITIPDIFANICPKDCSGNGNCVRGICVCKDGFSGKACSIDT
NKPPELTGIKGGLACDFGANDCSEVTIFGKGFIKGNDLTCHYTALDMNLVKKRFEETNDV
FTTKAVFISSQSVVCRSPRNEAFIISVSNDGTKLSKSIYYIAYDPICMLCNNKGCYVNDD
ICVIDGKCYKDGFTNPTDRSQVCQPKKSVNDWQLLKVTDVTIQRFRFIRIIGNILITSQF
NFTVFGNPNFLPGPQGGNALVLDGIKQYLDFGDYQNTCLFDLGQCRYGLSISFNLQIRKF
VNKMQILNNDAINMWWEGNRLYLQVRLENRVWTVKPKFHKRITSYVNIKFSWSFQQGIKI
FFDGKNVAYSKKYKRLRKLPKIFKKFLIGRSVDGKRFGSFYLADWSVIFAVDEIIQKFDI
NVELPKFETRPIVEMTVHNETKQVSFDCKFKELTKSNLKYSIKWYLNTKVLSEETVNIVD
GFGTSQLTEDQFENLELNDQIYCAVSACVENNCEETKGPERNSLPIIAHVKILTEKVTVY
EGSMFNYIEITATVPPRLFCLAQDRERSCRLLVRTLLSRERREVKCQTGEEIVQAVFGVA
HVDDKMPPCAYSITMDNWMTNLRIPIKGTIDQLKDRDQKREVKITVDVYASELIFQSVII
GEVELTIKDRDRTSMCKTYGDPHIYSFDNTRHNNFYEGEFLMYKHKTLPYEVHTFQRDCG
GRVKVSCNCAVAIKSGDDVIVMDRCGPKRQGRGRFIPLEPRIYLNGELTPGTKIFRYRGG
RKFEVVLPTGTRVKVVHGKSGFSAYLRIYVKASSIDYMNVEGFCGPFDDDKSNDLMLADG
TLYPGRSKHPDSFIVSWRVSKSESLYYGTCPEEEVDAIVDETKYCQCLEDSEAVCDAGLD
IGPCTAKTSRRRATDITNSLVVSARDVQHCLRINQIEWEFTLTYTAIVISWPTPSGITLD
IAVSICRNFIINTGIYEKCKNFIDLDAALLSCVEDIQILDDKKEVTGTLFDDVFLTCMTS
VEIDVSLWITVEGGLIIPPPAITDKLCPDDCNGHGKCDQGVCKCDKDWLGTACDVNAKEP
PTLISISGNEFCDNQRFNCFSVTVFGLDFAEVDTLKCQLVKDGETIVVPAEFHSPENVIC
KIPTTWYGKVTISVCNDGITFSIIKLEYTIYNSVCQVCNKDGCNERDDVCRINGKCLADG
FFDPEDASKYCSVKLSKTDWTVISIDEIKEKRITFKEIIDRIIITNSVNITFTGNVRLEI
NERNKKAIKCGVGAFLDLTSVNHPCFSDPDKCTLGLTFSFSLKLKTIKDDSYLLSSCAEE
TDGIGMSIYYKRKRMYITVSSRKRQWILISKNIKLNKYFDYEVSWSKQTGLQLYVDKKSN
AKTTKYFDRDVQTPLQCNLFLGKKAKPGSQNIMNEFEIELWQAVYAVKEVVQKLDVVVGY
PKLPKLPEVKVEILESRKVNFVCEFELIKGYDVEYEIEYYLGETSLFKDRLKDGIIPRLA
SNKITKITSNMQIKCSVVACFKDNCEGSQGPPSVGPGVSPGIQIITKSLTVIEGSINEMI
KIKSNVPPSFFCGDDEDCEVRIMAGIRAAKEQKCPDKRVIPQAVIAWTGDVDQAPFCGVT
LSKAKWNEYHLIAVKGVVDSLKDGDKNRVVEVWVSVITKVKTIKIELGQVKLKIKDGDKA
SICKSVNDPHITTFDGRRYDNFFEGEFVLYRHETLPYAVHAFYRACSDSKYSTASCNCAV
AIRVDDDVLVLDKCGAKRTYRPYPMKITLYQNEELTEGFIITQERSRKYRIYLPNGVKVV
VKTQRMKSLMNIWVTSSSTDVGQTEGLCGVLDGDKSNDLKMRNGQISTEKDKFPDAFSKT
WRVSKEESLYDGYCGKTTLKEKSAVYCDCMFGEEAVCSPGLDVFDCRKKSKKPRSRVKDI
TNRLSEDSVRPLKCVSTEPRVTFEYNITYIHKVVNYGIKFDEAEGHCNNKLGSLPAVKDI
KDIIGVDNVQASLEFCVNDIMLTGDYTWVNVLLDNVKEQCILNVEVNVDKWITGPDNIPL
LPPAIDNICPNECSGNGTCKEVIDNICPNKCSGKGTCKEAIDDICPNKCSGKGTCKEAID
DICPNECSGKGTCKEGECECNEGFKGDDCSIAIARPPDVVSISEGPLCDTLQNNCSIINI
YGLQFAETIWCKFQKLTMTTFQIDTGKAAEINVGIYQSEEQIQCMVPDPSSSYFVSISND
QIEFSATLKIVVYSSTCMTCTDTGCTERNDVCKIEGKCYENGFVNEEDESEIVGNILVTK
AYNLTLVGSPVTDVGPLGGLAIVLNGLGQYIVLGDRVGECLGDIEKCPLGLTISFKLKFK
SLIEGGIILSSGAEKRDKYGMVMWYENGRINLKVSTKTKEWSVSVSKVSLNKFVKFKFSW
SRQIGLRFYLDEKLEVNNKKFIARTAATVARSTKFHIGCGVEQERFANFTIQSLKIVEAI
EETTEKLKVITELPVFEMAPKLKVVVDKLISLECSFEKLTEVENEKYTVKFYSGETVIET
VTVTDGNSTTIDESKLGKLTFGGSLKCGVSACFTNDCFETSGPERMSEVIQTSIQVLTKE
ITVYEGGVEEYIMVSTLFPPRLFCAANEDCRFRIKPSFLSVKKEIKCADRREIPQALIGW
MGGKEETAFCGADITQTNWETVLKIPVKASIDSLKDKDQTRKIQISVQLIRNTVVESLNF
QHIIVVTIIDQDRIRLCSSTGDPHMKTFDGRKYNNFLEGEFLMYKHKTLPYEVQGFYRSC
LNKAACTCAVAVRSGDDVVVIDRCGSMRGKPNRRTPLTINLYLNGELTPGTRILRYRNGK
EFRVILPTGAMVKVRKSKAVGGRYLDAWIKPATVDRDNAIGLCGNFDGDNTNDLIIRQTG
VLFTKRTKQPTEFSKSWRVTKEESLYTGSCVLEEKKVEKEPIFCSCQGETEVCGLLTKDT
SCSSVSTKQRGRRGRRGEDITEKLMTSLDTQNPPKKCLTQQILVFFEFDINYVFPEVSWP
TASGRTEVQAAAECKRVIEESVSGAACKKVAGVAVTESLATCIEDIKITDLVEWAESAFN
NFIEECTNTIENNVELWETKNINGTEEIIPPPDIVDKICDGDCSGHGTCVEGECECEENY
TGDDCSLNKQEPPVLYEVLKPICDTRLSNCKQIAVFGASFIQSENLVCKLEKMQRTDVTF
TATGDTLTVNATFISDEQVRCEVDTANTYRVAVSNDGGKLDSTTKALFVSYDSACYSCTK
DGCTLKSDVCDINNECYGEGFVNLENYVQKCSPGKTTWTDITKEEIKVFKFFFLRIEQNK
LVTLSGNFDLFNNPSFTDGMKGNKAIQLNSEQKQYMTISDNVACILNPMNCKLGLTISFN
IRVRKFEENVVLLTSGADKEDGYGLALIRKTNSFLLVISTDTQEWSILTQDIQLNVFVSV
KISWSVQIGLKLYLDGEEKATAKTFIPRNVTATETDRFIVGKAAEKEAFADMDIEHVQVI
DAVQETADALNVDVEETTEAPQTTETSTNSTTDTTDGRTESTTDGVSESTTESATESTTD
GITESTTDGVTESTSESTTDGVTESTTESTTDGVTESTTESATEITTDGTTESTTDGATE
STTDGATESTTDGATESTTDTATESTTDTATESTTDTATESTTDTATESTTDTATESTTD
TATESTTDTATESTTDTATESTTDSTTSTKCIDSADSYPKMPGAPDLTFEQVDDKLSFTC
TPQKVTSEDGVVYTVTWVVNAIDVGTGDIATEESHILSYQDITNSEAVLDSGISCKVTAR
NPRRCVVETSPAISSIPLPAFTRQVVDAENMELVEGAASKSVKVTLSQSQQYYCLLKFKQ
TCEISFEAKAIRADKPNKCINGKLINGIAVDYTGELATASCKAPMTGQEHTISLSAVSDR
KVMRTDVESTVQIIEHVSYGEQTKSETLGEFKVKVKSVDVRGAYCKTVGDPHIRTFDGQT
FDNLRTGEFTIYKNTEMEVEVRGLFTETGSGSSSCGFLVRSGDDIIKLSKCELEENSEAF
PLIPELLLKDELTPNTKIFQENGGNKYKILLPSGTQIVVRNDVKRATNVWIVPSGEDFGK
TTGLCGNYNDDDTDDVRSKDGTDYTVDDATVDDAFLLSWRIEDSASQYSGYVGTLNMPTP
IYCTCYDGEDPVCGYFNNIDDCGVTTSGEEITQRLLDDAKAQAEQQAVTRRKRATNSFQY
NPDFNAAASATWPTASGITEAKARELCTSRIQVSKAFKACSNFSATNYATEINNCVTDVK
LTDDISWADATLADIQEQCEIDVLKNPENWVNQSNGIPALPTTITTSLCLNDCSGNGTCV
DGSCDCNTGYAGIDCSSTTTVAPTVLPGSSNALCDQSTACDQIVIRGDNFHQSSNCHMEE
IEIDESGIKSRGEVFLIAAKYRSTYEVSCPMPNDVKRSYAIRISNNAGDKSFAEALFSVY
DPKCLACTVSSKDSTGTCPRRSDVCHIEKKCIQPNSIKTGEPCYICNPPISTTSWSSTGA
SGCPSPPPPTKSPTTSKPKIDMTDNDTRTAIIVSGTIASTILVVIILVSVVFYRRHMLRK
ERKIPSYSGSDDGIYNNGSRVYDGFHGLRTENTLTLRPREYLGGTL
Download sequence
Identical sequences V3ZYS4
jgi|Lotgi1|234824|estExt_fgenesh2_pg.C_sca_560001 XP_009061401.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]