SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234884|estExt_fgenesh2_pg.C_sca_560115 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234884|estExt_fgenesh2_pg.C_sca_560115
Domain Number 1 Region: 160-212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000222
Family Complement control module/SCR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234884|estExt_fgenesh2_pg.C_sca_560115
Sequence length 928
Sequence
MKCIDNVGLVVTLAVIAVIVGGQDTTTETISTAGQTDVAPVKITTNNPSTTDTNVPTTGA
STAGSSTAGSSTAGSSTVGSSTAGLPTTGFPTSTAAAAPVVSAVAAPVVPASAPVMTPQQ
PPASNTPQPLPASQPQPQTSSNQVSNIVPMPPVPGMASICPKPIDVRGASYTVYGAFAVY
RCRPGFVYDQHVSMCQPDSTWTPPEIICKPRTFVKPIVTTNTNQGHNIVQNMYAFISAME
AAGSRSLSSQDLIGAFKSILTGTADITKLQQGLLTNPTPQVQQPQPTFNQQPTQPSPTIQ
NTNQFQNPTVPIQQTNLMPQNQPASQFPTQQKPVSQFTNPQQQQPNTQFQNQQQPNSQFP
NQQQQPKNQFQNQQQQTVPQFANPQIVSQYPNQQQTVSKFPNQQQTNFGLNQPTQPMSNN
NPQTFNKNQAMYPQNQQSFPNQQKQQFQNPPQSFQSNMMNKQFTQPQQQLNPNRQFQSQQ
PQQPQYNQQNMQNANPPYQQFQQQPMQQPSNQPLSQQQMLQQKIQIVQNQMQPSTQQTNQ
FMPQQQQQQQQQQQPQNQQQLQQQQLQQQIQQQQMQLQQQQQQLQQQIQQQRSFQQQQQQ
QQPMQPNQNVPTLNQFQIQNPASQAAQIPSTVAKSSPTANNPAEGVLRQLLGTQYDTMSP
ALKAVLLGEQSKTPPPTAAAPPVQQPSNDPLAALLGGGGNNKASNAGMPSLFDFGSMFGG
SNGTANPFGMGGGMMNMMDPEMMAEMHEQRLAASLVHKLSGKGGLPGTNPLAALGAAGAG
LGAGGLGGNQMDPLAGLLSGTGGLFGGAGGAGSGSPFDALLGGGGAGGAGGMNLGNPLEA
LLGGGQAGPDALLGGPGGAGAGGNQLAALLGDVPGMSHPGSGAHPTAGANLPSSGNPSQT
PSSSSGNSAVNAETMKMMKKLGLMKKKK
Download sequence
Identical sequences V4BH92
jgi|Lotgi1|234884|estExt_fgenesh2_pg.C_sca_560115 XP_009061500.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]