SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234925|estExt_fgenesh2_pg.C_sca_570030 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234925|estExt_fgenesh2_pg.C_sca_570030
Domain Number 1 Region: 312-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000115
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 2 Region: 785-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000292
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 3 Region: 978-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000529
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 940-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000879
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 471-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000912
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 6 Region: 590-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000712
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 7 Region: 789-912
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000121
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 276-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 9 Region: 906-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000182
Family EGF-type module 0.006
Further Details:      
 
Domain Number 10 Region: 392-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 550-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 12 Region: 707-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000031
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000369
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 14 Region: 747-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000456
Family EGF-type module 0.016
Further Details:      
 
Domain Number 15 Region: 668-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000457
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 16 Region: 1023-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 432-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000366
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 1057-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000439
Family EGF-type module 0.026
Further Details:      
 
Domain Number 19 Region: 239-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000679
Family EGF-type module 0.021
Further Details:      
 
Domain Number 20 Region: 360-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000709
Family EGF-type module 0.01
Further Details:      
 
Domain Number 21 Region: 510-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000268
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234925|estExt_fgenesh2_pg.C_sca_570030
Sequence length 1180
Sequence
MSRITNVIPYFIILILYQLILITSADFIVSLDTSNFRRSNLNLDQTVTCESGRCAGLLYY
CIQTAGALSTSKEVCSYGYKHVATGDAVLNAPSSGDSIPIRGSFRPISIRIEVFHQQTDK
DAIKLLTYRVEFKESMNNYQDWYPVNLDDAVIQEDVSIVQGLAPIYMKISCSGNYYGSDC
SVYCSTYNDIHKHCRSNGTKVCAPGWTGDNCTTAVPVEEVNTVEDEGESLRRSKRQIDNP
CNSAPCKNGATCDRLNENDYACICYIDYTGEFCDRGIDDCESSPCKNGICIDNIGYFNCS
CYFGYTGSLCETDIQECSSNPCLNGATCSEERVGTFRCICAEGFTGKRCEIDIDECTVFS
PCWNGGECLEGPPGNYTCICPKGFGGVQCRIDINECDPNPCSNGGTCLEQAPGEFVCRCP
IGLQGEFCELDTDECFPVNPCQNGGVCSNGPRGVYICRCPEGFDGQDCENEVDECKSAPC
MNGGTCRNTSPGNFACTCAEGFTGERCGTDIDECQVLQPCRNGATCQQGIPGTFTCLCPI
GFQGQVCDEDINECAAAPCKNGGTCSNSNKPGEFICQCLPGYNGVTCDGEIDFCNRRPCQ
NGGSCIQNQPGTYNCICIRGFTGKNCESDVDECLSQPCRNGATCSQPIPGTYQCDCAKGY
NGTQCDNDINECASGPCLNGAVCNQGRPGSFICSCRPGYTGIICEADIIECNSQPCQNGG
TCKEPQPGMFQCQCPTNFRGRVCEAEIEACSSQPCRNGGSCESLAGGNYRCTCQPGTTGS
QCEEDIDECAENPCLNSGTCSQPKLGDFFCSCPDGYYGKRCDVDIDECEVLKPCYNNGTC
KNGDPGEYECTCSPGFRGDNCAVDINECVPNPCLNRGKCIEGAPATYNCTCADGYFGARC
QQEELCHNKCQNGGTCEEITESDYICYCVPGFTGRNCQVNIDECTVNPCQQDGLCIDGIN
NYFCACMKGTTGKFCETNINDCSPTPCLNGAKCTDWTDDYYCTCPNNYAGKNCEKSEPGA
VYVACARNQCLNAGMCWQNRDGSFRCECPKGFSGVRCEINLNDCGSRPCKTGAKCYDWID
DFYCYCPTWTYGKYCDNITTIPVTTVAQPQFGTARYGINPLTLAILLGIIFGIVFILFLA
GVIWFYLGRRGPKDFCFALPSSMYNKLYDWHESTFSSDRF
Download sequence
Identical sequences V4A2Z5
jgi|Lotgi1|234925|estExt_fgenesh2_pg.C_sca_570030 XP_009061573.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]