SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235132|estExt_fgenesh2_pg.C_sca_600021 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|235132|estExt_fgenesh2_pg.C_sca_600021
Domain Number 1 Region: 621-813
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000374
Family Pentraxin (pentaxin) 0.054
Further Details:      
 
Domain Number 2 Region: 485-539
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000759
Family Tachycitin 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|235132|estExt_fgenesh2_pg.C_sca_600021
Domain Number - Region: 86-203
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0366
Family Pentapeptide repeats 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235132|estExt_fgenesh2_pg.C_sca_600021
Sequence length 824
Sequence
MSRYYKLHLHNVKLLQTSSSPYQHITNFIFTMSSYYKLPLHNVKLLQTSSSQCQDITNFI
FTMSRYYKLHLHNVKLLKTSSSPYQDITNFIFTMSSYYKLHFYNVKLLRTSFLQCQAITN
FIFTMSSYYKRHLHNVKLLQTSSLQCQAITNCILTMSRYYKLHLHNVKLLQTSSSQCQDI
INSIFTMSSYYKLHLHNVNILQTSSSQCQAITNFIYWLLLYKTSSCQHQTSDERETGLLL
ILQVNIRLYISYCVVNIRLYVSYFVDNIRLFMYRILLTQCIENIGWGHYPLGIVSTLRLR
TLNMRFFFSLSLAIVAFLAHYNNAALRAANPSRNGEIPIFEANQLKAVATVYTIGVQKLS
GVDYNVNELQQISTSGNQVDIPANNNVNQQVTVLLNEFDKIANLGCGGSVVTGPSVSNSV
CDECAAENGVGYVTYRNSAGVVDGRYFIQCKREDFGNGFIANVLRCPDSLFWHDDLKNCV
GLISSDNYEGQCDSGTYVFASVSCGAYFNCTDGQVRSQCCPDNTGFDPVQKRCVTDPTCK
FHCSDPSLSRAANCDKEPVIMQTGQVNPCKFKWIVSPSVSYEMPCAVGTNFNQTACSCTI
HSNGTCPGVYNDPCDPDVNVNFNNNKVVDTRGSTVVNKGGAAVNNGIATFNGQNRQRVQF
MRYTNNDFTLPLAIKIKYRDTESKQNMALVATGDCLSKPGLYVLVGNSQVTLGLHTESQG
YSTKYETSTNAPGLNQWKEVVFHFDGSVLQGEVRTLDSNGNSIVNRSPIPPRTVSSGAGV
RILETEGAMVLGYAHDSGYPGFVGDVDEFTVWRGCKAKASPSEY
Download sequence
Identical sequences V4BDS1
XP_009062324.1.39240 jgi|Lotgi1|235132|estExt_fgenesh2_pg.C_sca_600021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]